Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_B2S9B6 50S ribosomal protein L20 n=24 Tax=Bacteria TaxID=2 RepID=RL20_BRUA1 MARVKRGVTAHAKHKKVLDQAAGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRSFRAL WIQRINAAVREQGLTYGRFIDGLAKAGIEIDRKVLSDIAIHEPEAFAALVASAKKALEYL KNTSMPNAFEGAVR

Members

Expand cluster to 90% or 50% identity.
1 to 24 of 24  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
B2S9B6RL20_BRUA150S ribosomal protein L20Brucella abortus (strain S19)430066134Representative & Seed
Q2YQV7RL20_BRUA250S ribosomal protein L20Brucella abortus (strain 2308)359391134
Q57AE2RL20_BRUAB50S ribosomal protein L20Brucella abortus biovar 1 (strain 9-941)262698134
A9M9V2RL20_BRUC250S ribosomal protein L20Brucella canis (strain ATCC 23365 / NCTC 10854)483179134
C0RG04RL20_BRUMB50S ribosomal protein L20Brucella melitensis biotype 2 (strain ATCC 23457)546272134
P66101RL20_BRUME50S ribosomal protein L20Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)224914134
A5VT72RL20_BRUO250S ribosomal protein L20Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)444178134
B0CJL8RL20_BRUSI50S ribosomal protein L20Brucella suis (strain ATCC 23445 / NCTC 10510)470137134
P66102RL20_BRUSU50S ribosomal protein L20Brucella suis biovar 1 (strain 1330)204722134
C0G300C0G300_9RHIZ50S ribosomal protein L20Brucella ceti str. Cudo595497134
C4ITV2C4ITV2_BRUAO50S ribosomal protein L20Brucella abortus str. 2308 A641140134
A0A0E1X1U4A0A0E1X1U4_9RHIZ50S ribosomal protein L20Brucella pinnipedialis M292/94/1520462134
C7LEZ5C7LEZ5_BRUMC50S ribosomal protein L20Brucella microti (strain CCM 4915)568815134
A0A0M1WCA9A0A0M1WCA9_BRUAO50S ribosomal protein L20Brucella abortus NCTC 8038575591134
D1CUM7D1CUM7_9RHIZ50S ribosomal protein L20Brucella sp. 83/13520449134
N8NA15N8NA15_BRUOV50S ribosomal protein L20Brucella ovis IntaBari-2002-82-581293916134
A0A4P6KMJ2A0A4P6KMJ2_BRUML50S ribosomal protein L20Brucella melitensis29459134
A0A4Q2SXV8A0A4Q2SXV8_BRUAO50S ribosomal protein L20Brucella abortus235134
A0A4Z0F6U7A0A4Z0F6U7_BRUSS50S ribosomal protein L20Brucella suis29461134
D7H0L9D7H0L9_BRUAO50S ribosomal protein L20Brucella abortus bv. 5 str. B3196520453134
E2PQZ5E2PQZ5_9RHIZ50S ribosomal protein L20Brucella sp. BO2693750134
D0RKT5D0RKT5_9RHIZ50S ribosomal protein L20Brucella sp. F5/99437701134
D6LM53D6LM53_9RHIZ50S ribosomal protein L20Brucella sp. NVSL 07-0026520448134
UPI000F79D87F50S ribosomal protein L20Bacillus sp. STP32338393101

Sequence

Representative sequenceiLengthMass (Da)Tools
B2S9B6

Checksumi: CD0B7B0574209DD4

FASTA13415,095
        10         20         30         40         50
MARVKRGVTA HAKHKKVLDQ AAGFRGRRKN TIRTAKAAVD RSKQYAYRDR
60 70 80 90 100
KNRKRSFRAL WIQRINAAVR EQGLTYGRFI DGLAKAGIEI DRKVLSDIAI
110 120 130
HEPEAFAALV ASAKKALEYL KNTSMPNAFE GAVR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again