Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_C1A1L7 50S ribosomal protein L21 n=13 Tax=Rhodococcus TaxID=1827 RepID=RL21_RHOE4 MATYAIVKTGGKQYKVAVGDLVKVEKIEGEPGTAVSLAPVLVVDGSDLTTDAAKLAKVAV TSEIVEHTKGPKIRIHKFKNKTGYHKRQGHRQPITVLKVTGIK

Members

Expand cluster to 90% or 50% identity.
1 to 13 of 13  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
C1A1L7RL21_RHOE450S ribosomal protein L21Rhodococcus erythropolis (strain PR4 / NBRC 100887)234621103Representative & Seed
A0A0C3A8V8A0A0C3A8V8_RHOER50S ribosomal protein L21Rhodococcus erythropolis (Arthrobacter picolinophilus)1833103
A0A069JK77A0A069JK77_9NOCA50S ribosomal protein L21Rhodococcus qingshengii334542103
A0A1C4ER46A0A1C4ER46_9NOCA50S ribosomal protein L21Rhodococcus enclensis1049584103
A0A328CIS7A0A328CIS7_9NOCA50S ribosomal protein L21Rhodococcus sp. AQ5-072054902103
A0A4Y7AND4A0A4Y7AND4_9NOCA50S ribosomal protein L21Rhodococcus sp. WS11882743103
A0A4R7XFE2A0A4R7XFE2_9NOCA50S ribosomal protein L21Rhodococcus sp. LP_11_YM2485207103
C3JRV2C3JRV2_RHOER50S ribosomal protein L21Rhodococcus erythropolis SK121596309103
A0A4R6XQV6A0A4R6XQV6_9NOCA50S ribosomal protein L21Rhodococcus sp. LP_3_YM2485208103
U0EF58U0EF58_9NOCA50S ribosomal protein L21Rhodococcus sp. P271384060103
A0A3G9A011A0A3G9A011_9NOCA50S ribosomal protein L21Rhodococcus sp. NJ-5302490853103
T5I691T5I691_RHOER50S ribosomal protein L21Rhodococcus erythropolis DN11381122103
A0A3N7AXF1A0A3N7AXF1_9NOCA50S ribosomal protein L21Rhodococcus sp. KBW082144188103

Sequence

Representative sequenceiLengthMass (Da)Tools
C1A1L7

Checksumi: 87472A4085FF8645

FASTA10311,060
        10         20         30         40         50
MATYAIVKTG GKQYKVAVGD LVKVEKIEGE PGTAVSLAPV LVVDGSDLTT
60 70 80 90 100
DAAKLAKVAV TSEIVEHTKG PKIRIHKFKN KTGYHKRQGH RQPITVLKVT

GIK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again