Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_C3KIP6 Superoxide dismutase [Cu-Zn] n=1 Tax=Anoplopoma fimbria TaxID=229290 RepID=C3KIP6_ANOFI MVVKAVCVLKGAGETSGVVHFEQEGDTAAAKLTGEIIDLTPGEHGFHVHAFGDSTNGCIS AGPHFNPHNNTHAGPTDEQRHVGDLGNVTAGGDNIAKIDITDKIITLTGQYSIIGRTMVI HEKADDLGKGGNDESLKTGNAGARLACGVIGVAQ

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
C3KIP6C3KIP6_ANOFISuperoxide dismutase [Cu-Zn]Anoplopoma fimbria (Sablefish)229290154Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
C3KIP6

Checksumi: 14561E8863056CD4

FASTA15415,821
        10         20         30         40         50
MVVKAVCVLK GAGETSGVVH FEQEGDTAAA KLTGEIIDLT PGEHGFHVHA
60 70 80 90 100
FGDSTNGCIS AGPHFNPHNN THAGPTDEQR HVGDLGNVTA GGDNIAKIDI
110 120 130 140 150
TDKIITLTGQ YSIIGRTMVI HEKADDLGKG GNDESLKTGN AGARLACGVI

GVAQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again