Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_D6RDH7 Stress-70 protein, mitochondrial n=2 Tax=Homininae TaxID=207598 RepID=D6RDH7_HUMAN MISASRAAAARLVGAAASRGPTAARHQIRSNQGSSCWY

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
D6RDH7D6RDH7_HUMANStress-70 protein, mitochondrialHomo sapiens (Human)960638Representative & Seed
A0A2J8LR86A0A2J8LR86_PANTRHSPA9 isoform 6Pan troglodytes (Chimpanzee)959838

Sequence

Representative sequenceiLengthMass (Da)Tools
D6RDH7

Checksumi: E7E51F8A29E866B8

FASTA383,931
        10         20         30 
MISASRAAAA RLVGAAASRG PTAARHQIRS NQGSSCWY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again