Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_E2RCY8 Aconitate hydratase, mitochondrial n=1 Tax=Canis lupus familiaris TaxID=9615 RepID=E2RCY8_CANLF MAPYSLLVTRLQSVFPFLKKALGVRQYHVASVLCQRAKVAMSHFEPHEYIRYDLLEKNID IVRKRLNRPLTLSEKIVYGHLDDPAKQDIERGKTYLRLRPDRVAMQDATAQMAMLQFISS GLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGII HQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVK LTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGAT TSVFPYNHRMKKYLSKTGREEIAKLADEYKDHLVPDPGCHYDQLIEINLNELKPHINGPF TPDLAHPVAEVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQ FTITPGSEQIRATIERDGYAQVLREVGGVVLANACGPCIGQWDRKDTKKGEKNTIVTSYN RNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELP RAEFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCT TDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKH GIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPA DYNKIHPVDKLTIQGLKDFAPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALN RMKELQQQ

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
E2RCY8E2RCY8_CANLFAconitate hydratase, mitochondrialCanis lupus familiaris (Dog) (Canis familiaris)9615788Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
E2RCY8

Checksumi: 05A24F925CA21133

FASTA78886,541
        10         20         30         40         50
MAPYSLLVTR LQSVFPFLKK ALGVRQYHVA SVLCQRAKVA MSHFEPHEYI
60 70 80 90 100
RYDLLEKNID IVRKRLNRPL TLSEKIVYGH LDDPAKQDIE RGKTYLRLRP
110 120 130 140 150
DRVAMQDATA QMAMLQFISS GLPKVAVPST IHCDHLIEAQ LGGEKDLRRA
160 170 180 190 200
KDINQEVYNF LATAGAKYGV GFWRPGSGII HQIILENYAY PGVLLIGTDS
210 220 230 240 250
HTPNGGGLGG ICIGVGGADA VDVMAGIPWE LKCPKVIGVK LTGSLSGWTS
260 270 280 290 300
PKDVILKVAG ILTVKGGTGA IVEYHGPGVD SISCTGMATI CNMGAEIGAT
310 320 330 340 350
TSVFPYNHRM KKYLSKTGRE EIAKLADEYK DHLVPDPGCH YDQLIEINLN
360 370 380 390 400
ELKPHINGPF TPDLAHPVAE VGTVAEKEGW PLDIRVGLIG SCTNSSYEDM
410 420 430 440 450
GRSAAVAKQA LAHGLKCKSQ FTITPGSEQI RATIERDGYA QVLREVGGVV
460 470 480 490 500
LANACGPCIG QWDRKDTKKG EKNTIVTSYN RNFTGRNDAN PETHAFVTSP
510 520 530 540 550
EIVTALAIAG TLKFNPETDF LTGKDGKKFK LEAPDADELP RAEFDPGQDT
560 570 580 590 600
YQHPPKDSSG QRVDVSPTSQ RLQLLEPFDK WDGKDLEDLQ ILIKVKGKCT
610 620 630 640 650
TDHISAAGPW LKFRGHLDNI SNNLLIGAIN IENGKANSVR NAVTQEFGPV
660 670 680 690 700
PDTARYYKKH GIRWVVIGDE NYGEGSSREH AALEPRHLGG RAIITKSFAR
710 720 730 740 750
IHETNLKKQG LLPLTFADPA DYNKIHPVDK LTIQGLKDFA PGKPLKCIIK
760 770 780
HPNGTQETIL LNHTFNETQI EWFRAGSALN RMKELQQQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again