Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_E6Y356 Superoxide dismutase [Cu-Zn] n=1 Tax=Kryptolebias marmoratus TaxID=37003 RepID=E6Y356_KRYMA MVAKAVCVLKGAGDTSGTVHFEQENESAPVRVTGEISGLAPGEHGFHVHAFGDNTNGCIS AGPHYNPFSKNHGGPTDEERHVGDLGNVTAGENNIAKINIEDSFIKLSGPHSIIGRTIVI HEKRDDLGKGGDEESLKTGNAGARLACGVIGIAQ

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
E6Y356E6Y356_KRYMASuperoxide dismutase [Cu-Zn]Kryptolebias marmoratus (Mangrove killifish) (Rivulus marmoratus)37003154Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
E6Y356

Checksumi: 4D3C57F3A0A8E14F

FASTA15415,975
        10         20         30         40         50
MVAKAVCVLK GAGDTSGTVH FEQENESAPV RVTGEISGLA PGEHGFHVHA
60 70 80 90 100
FGDNTNGCIS AGPHYNPFSK NHGGPTDEER HVGDLGNVTA GENNIAKINI
110 120 130 140 150
EDSFIKLSGP HSIIGRTIVI HEKRDDLGKG GDEESLKTGN AGARLACGVI

GIAQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again