Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_F1RNZ8 Myocyte-specific enhancer factor 2C n=27 Tax=Boreoeutheria TaxID=1437010 RepID=F1RNZ8_PIG MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST DMDKVLLKYTEYNEPHESRTNSDIVEALNKKENKGCESPDPDSSYALTPRTEEKYKKINE EFDNMIKSHKIPAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSM SPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPP PMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQSLATPVVSVATPTLPGQGMGG YPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACT STHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSS YDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT

Members

Expand cluster to 90% or 50% identity.
1 to 25 of 27  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F1RNZ8F1RNZ8_PIGMyocyte-specific enhancer factor 2CSus scrofa (Pig)9823463Representative & Seed
A0A2U3W5F0A0A2U3W5F0_ODOROmyocyte-specific enhancer factor 2C isoform X4Odobenus rosmarus divergens (Pacific walrus)9708463
A0A2J8UX29A0A2J8UX29_PONABMEF2C isoform 3Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601463
A0A2J8NMP1A0A2J8NMP1_PANTRMEF2C isoform 1Pan troglodytes (Chimpanzee)9598463
F7E2K3F7E2K3_CALJAMyocyte-specific enhancer factor 2C isoform 2Callithrix jacchus (White-tufted-ear marmoset)9483463
F7FUA8F7FUA8_MACMUMADS-box domain-containing proteinMacaca mulatta (Rhesus macaque)9544463
A0A2Y9JJC2A0A2Y9JJC2_ENHLUmyocyte-specific enhancer factor 2C isoform X3Enhydra lutris kenyoni391180463
A0A2U3YMR5A0A2U3YMR5_LEPWEmyocyte-specific enhancer factor 2C-like isoform X5Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713463
A0A2I2UI60A0A2I2UI60_FELCAMADS-box domain-containing proteinFelis catus (Cat) (Felis silvestris catus)9685463
A0A2Y9HTJ5A0A2Y9HTJ5_NEOSCmyocyte-specific enhancer factor 2CNeomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088463
A0A3Q7NMI3A0A3Q7NMI3_CALURmyocyte-specific enhancer factor 2C isoform X2Callorhinus ursinus (Northern fur seal)34884463
A0A2K5Z3B3A0A2K5Z3B3_MANLEMADS-box domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568463
G1RTR8G1RTR8_NOMLEMADS-box domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853463
A0A384CX32A0A384CX32_URSMAmyocyte-specific enhancer factor 2C isoform X2Ursus maritimus (Polar bear) (Thalarctos maritimus)29073463
A0A2K6MD54A0A2K6MD54_RHIBEMADS-box domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621463
A0A3Q7VQE6A0A3Q7VQE6_URSARmyocyte-specific enhancer factor 2C isoform X2Ursus arctos horribilis116960463
A0A485MGI2A0A485MGI2_LYNPAMyocyte-specific enhancer factor 2c isoform 2Lynx pardinus (Iberian lynx) (Felis pardina)191816463
A0A2K6F5B7A0A2K6F5B7_PROCOMADS-box domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532463
A0A2K5HR45A0A2K5HR45_COLAPMADS-box domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983463
A0A3Q0ELJ3A0A3Q0ELJ3_TARSYmyocyte-specific enhancer factor 2C isoform X4Tarsius syrichta (Philippine tarsier)1868482463
A0A250Y1F7A0A250Y1F7_CASCNMyocyte-specific enhancer factor 2CCastor canadensis (American beaver)51338463
A0A287DB66A0A287DB66_ICTTRMADS-box domain-containing proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179463
A0A5E4BVX6A0A5E4BVX6_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995463
Q06413-6Isoform 6 of MEF2C_HUMAN6Homo sapiens (Human)9606463
A0A0D9RQI1A0A0D9RQI1_CHLSBMyocyte enhancer factor 2CChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711446

Sequence

Representative sequenceiLengthMass (Da)Tools
F1RNZ8

Checksumi: B78282622DC98CE5

FASTA46350,242
        10         20         30         40         50
MGRKKIQITR IMDERNRQVT FTKRKFGLMK KAYELSVLCD CEIALIIFNS
60 70 80 90 100
TNKLFQYAST DMDKVLLKYT EYNEPHESRT NSDIVEALNK KENKGCESPD
110 120 130 140 150
PDSSYALTPR TEEKYKKINE EFDNMIKSHK IPAVPPPNFE MPVSIPVSSH
160 170 180 190 200
NSLVYSNPVS SLGNPNLLPL AHPSLQRNSM SPGVTHRPPS AGNTGGLMGG
210 220 230 240 250
DLTSGAGTSA GNGYGNPRNS PGLLVSPGNL NKNMQAKSPP PMNLGMNNRK
260 270 280 290 300
PDLRVLIPPG SKNTMPSVNQ RINNSQSAQS LATPVVSVAT PTLPGQGMGG
310 320 330 340 350
YPSAISTTYG TEYSLSSADL SSLSGFNTAS ALHLGSVTGW QQQHLHNMPP
360 370 380 390 400
SALSQLGACT STHLSQSSNL SLPSTQSLNI KSEPVSPPRD RTTTPSRYPQ
410 420 430 440 450
HTRHEAGRSP VDSLSSCSSS YDGSDREDHR NEFHSPIGLT RPSPDERESP
460
SVKRMRLSEG WAT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again