Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_F7CXY0 RNA binding motif protein 14 n=12 Tax=Catarrhini TaxID=9526 RepID=F7CXY0_MACMU MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHEL RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKGKRMHVQL STSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSY GDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLT STSLDPYDRHLLPTSGAAATAAAAAAAAAAVTAASTSYYGRDRSPLRRATAPVPTVGEGY GYGHESELSQASAAARNSLYDMARYEREQYADRARYSAF

Members

Expand cluster to 90% or 50% identity.
1 to 12 of 12  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F7CXY0F7CXY0_MACMURNA binding motif protein 14Macaca mulatta (Rhesus macaque)9544339Representative
A0A2K6RMN6A0A2K6RMN6_RHIRORNA binding motif protein 14Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622339Seed
A0A2I3T4A2A0A2I3T4A2_PANTRUncharacterized proteinPan troglodytes (Chimpanzee)9598339
A0A2K5MKG0A0A2K5MKG0_CERATRNA binding motif protein 14Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531339
A0A2I3N3U5A0A2I3N3U5_PAPANRNA binding motif protein 14Papio anubis (Olive baboon)9555339
A0A2R9AZA7A0A2R9AZA7_PANPARNA binding motif protein 14Pan paniscus (Pygmy chimpanzee) (Bonobo)9597339
A0A2K5XQV2A0A2K5XQV2_MANLERNA binding motif protein 14Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568339
A0A2I2YMV3A0A2I2YMV3_GORGORNA binding motif protein 14Gorilla gorilla gorilla (Western lowland gorilla)9595339
A0A2K5WC74A0A2K5WC74_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541339
A0A2K6MV19A0A2K6MV19_RHIBERNA binding motif protein 14Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621339
A0A2K6AVQ6A0A2K6AVQ6_MACNERNA binding motif protein 14Macaca nemestrina (Pig-tailed macaque)9545339
Q96PK6-5Isoform 5 of RBM14_HUMAN5Homo sapiens (Human)9606339

Sequence

Representative sequenceiLengthMass (Da)Tools
F7CXY0

Checksumi: 3618E2DA670C7E21

FASTA33937,035
        10         20         30         40         50
MKIFVGNVDG ADTTPEELAA LFAPYGTVMS CAVMKQFAFV HMRENAGALR
60 70 80 90 100
AIEALHGHEL RPGRALVVEM SRPRPLNTWK IFVGNVSAAC TSQELRSLFE
110 120 130 140 150
RRGRVIECDV VKGKRMHVQL STSRLRTAPG MGDQSGCYRC GKEGHWSKEC
160 170 180 190 200
PIDRSGRVAD LTEQYNEQYG AVRTPYTMSY GDSLYYNNAY GALDAYYKRC
210 220 230 240 250
RAARSYEAVA AAAASVYNYA EQTLSQLPQV QNTAMASHLT STSLDPYDRH
260 270 280 290 300
LLPTSGAAAT AAAAAAAAAA VTAASTSYYG RDRSPLRRAT APVPTVGEGY
310 320 330
GYGHESELSQ ASAAARNSLY DMARYEREQY ADRARYSAF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again