Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_F8J413 Group 13 grass pollen allergen (Fragment) n=1 Tax=Paspalum notatum TaxID=147272 RepID=F8J413_PASNO MAWRKEEGAMTMLRALLVVALAVCGAHAAGDKKKAEESKKGDSPAAAAASGPGGSFDITK LGASGDGKTDSTKALEEAWASACGGKGKQTILIPKGDYLTGALNFTGPCTGDVTFQLDGN LLASTDLSQFKANWIEILRVDNLVITGKGKLDGQGSAVWSKNSCAKKYDCKILPNSLVLD FCNKAEVSGISIINSKFFHMNVFQCKDVVIKDVTVSAPGDSPNTDGIHMGDSSGVSIIDT TIGVGDDCISIGPGSTKVNITGVTCGPGHGISIGSLGRYKDEKDVTDINVKDCTLKKSSN GLRIKAYEDAKSVLTCSNIHYENVKMEDAGYPIIIDMKYCPNKICSASAGSKVTVKDVTF KDITGTSSTPEAVSLLCSDSTPCSGITMNNVKVEY

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F8J413F8J413_PASNOGroup 13 grass pollen allergen (Fragment)Paspalum notatum (Bahia grass)147272395Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
F8J413

Checksumi: 500EE80CE6C26750

FASTA39541,356
        10         20         30         40         50
MAWRKEEGAM TMLRALLVVA LAVCGAHAAG DKKKAEESKK GDSPAAAAAS
60 70 80 90 100
GPGGSFDITK LGASGDGKTD STKALEEAWA SACGGKGKQT ILIPKGDYLT
110 120 130 140 150
GALNFTGPCT GDVTFQLDGN LLASTDLSQF KANWIEILRV DNLVITGKGK
160 170 180 190 200
LDGQGSAVWS KNSCAKKYDC KILPNSLVLD FCNKAEVSGI SIINSKFFHM
210 220 230 240 250
NVFQCKDVVI KDVTVSAPGD SPNTDGIHMG DSSGVSIIDT TIGVGDDCIS
260 270 280 290 300
IGPGSTKVNI TGVTCGPGHG ISIGSLGRYK DEKDVTDINV KDCTLKKSSN
310 320 330 340 350
GLRIKAYEDA KSVLTCSNIH YENVKMEDAG YPIIIDMKYC PNKICSASAG
360 370 380 390
SKVTVKDVTF KDITGTSSTP EAVSLLCSDS TPCSGITMNN VKVEY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again