Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_F8J415 Group 13 grass pollen allergen (Fragment) n=1 Tax=Paspalum notatum TaxID=147272 RepID=F8J415_PASNO MAWRKEEGAMTMLRALLVLALAVCGAHAGAKKAEESKKGDSPAAAAASGPGGSFDITKLG ASGDGKTDSTKALEEAWASACGGKGKQTILIPKGDYLTGALNFTGPCTGDVTFQLDGNLL ASTDLSQFKANWIEILRVDNLVITGKGKLDGQGQAVWSKNSCAKKYDCKILPNSLVLDFC NKAEVSGISIINSKFFHMNVFQCKDVVIKDVTVSAPGDSPNTDGIHMGDSSGVSIIDTTI GVGDDCISIGPGSTKVNITGVTCGPGHGISIGSLGRYKDEKDVTDINVKDCTLKKSTNGL RIKAYEDAKSVLTCSNIHYENVKMEDAGYPIIIDMKYCPNKICSASAGSKVTVKDVTFKD ITGTSSTPEAVSLLCSDSTPCSGITMNNVKVEY

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F8J415F8J415_PASNOGroup 13 grass pollen allergen (Fragment)Paspalum notatum (Bahia grass)147272393Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
F8J415

Checksumi: 5A931ED078E629A1

FASTA39341,182
        10         20         30         40         50
MAWRKEEGAM TMLRALLVLA LAVCGAHAGA KKAEESKKGD SPAAAAASGP
60 70 80 90 100
GGSFDITKLG ASGDGKTDST KALEEAWASA CGGKGKQTIL IPKGDYLTGA
110 120 130 140 150
LNFTGPCTGD VTFQLDGNLL ASTDLSQFKA NWIEILRVDN LVITGKGKLD
160 170 180 190 200
GQGQAVWSKN SCAKKYDCKI LPNSLVLDFC NKAEVSGISI INSKFFHMNV
210 220 230 240 250
FQCKDVVIKD VTVSAPGDSP NTDGIHMGDS SGVSIIDTTI GVGDDCISIG
260 270 280 290 300
PGSTKVNITG VTCGPGHGIS IGSLGRYKDE KDVTDINVKD CTLKKSTNGL
310 320 330 340 350
RIKAYEDAKS VLTCSNIHYE NVKMEDAGYP IIIDMKYCPN KICSASAGSK
360 370 380 390
VTVKDVTFKD ITGTSSTPEA VSLLCSDSTP CSGITMNNVK VEY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again