Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_F8J418 Group 13 grass pollen allergen (Fragment) n=1 Tax=Paspalum notatum TaxID=147272 RepID=F8J418_PASNO STGINITGVTCGPGHGISVGSLGRYKDEKDVTDINVKGCTLKKTSNGVRIKSYEDAASVL SASNLHYENIAMEDVANPIIIDMKYCPNKICTKNGASKVTIKDVTFKNITGTSSTPEAVS LLCSEKLPCTGVTLDNVKVEYKGTNNKTMAVCNNAKGSSTGCLKELACL

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
F8J418F8J418_PASNOGroup 13 grass pollen allergen (Fragment)Paspalum notatum (Bahia grass)147272169Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
F8J418

Checksumi: 48BC2E17967E7BBB

FASTA16917,815
        10         20         30         40         50
STGINITGVT CGPGHGISVG SLGRYKDEKD VTDINVKGCT LKKTSNGVRI
60 70 80 90 100
KSYEDAASVL SASNLHYENI AMEDVANPII IDMKYCPNKI CTKNGASKVT
110 120 130 140 150
IKDVTFKNIT GTSSTPEAVS LLCSEKLPCT GVTLDNVKVE YKGTNNKTMA
160
VCNNAKGSST GCLKELACL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again