Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_G3QDA8 Interleukin 1 receptor associated kinase 1 n=1 Tax=Gorilla gorilla gorilla TaxID=9595 RepID=G3QDA8_GORGO MAGGPGPGESAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFXXXXXXXXXXXXXXX XXXXXXXXXXXPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPSTTAPRPSS IPAPAEAEAWSPRKLPSLASTLLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK PGPESSVSLLQGARPSPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR LKEDADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLTG QRAVKTHGARTKYLVYERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGSAHSGAA PWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAG CPQGPTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDG ALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
G3QDA8G3QDA8_GORGOInterleukin 1 receptor associated kinase 1Gorilla gorilla gorilla (Western lowland gorilla)9595633Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
G3QDA8

Checksumi: 29B4CC63DF5578D6

FASTA63368,295
        10         20         30         40         50
MAGGPGPGES AAPGAQHFLY EVPPWVMCRF YKVMDALEPA DWCQFXXXXX
60 70 80 90 100
XXXXXXXXXX XXXXXXXXXX XPWINRNARV ADLVHILTHL QLLRARDIIT
110 120 130 140 150
AWHPPAPLPS PSTTAPRPSS IPAPAEAEAW SPRKLPSLAS TLLSPAFPGS
160 170 180 190 200
QTHSGPELGL VPSPASLWPP PPSPAPSSTK PGPESSVSLL QGARPSPFCW
210 220 230 240 250
PLCEISRGTH NFSEELKIGE GGFGCVYRAV MRNTVYAVKR LKEDADLEWT
260 270 280 290 300
AVKQSFLTEV EQLSRFRHPN IVDFAGYCAQ NGFYCLVYGF LPNGSLEDRL
310 320 330 340 350
HCQTQACPPL SWPQRLDILL GTARAIQFLH QDSPSLIHGD IKSSNVLLDE
360 370 380 390 400
RLTPKLGDFG LARFSRFAGS SPSQSSMVAR TQTVRGTLAY LPEEYIKTGR
410 420 430 440 450
LAVDTDTFSF GVVVLETLTG QRAVKTHGAR TKYLVYERLE KLQAVVAGVP
460 470 480 490 500
GHSEAASCIP PSPQENSYVS STGSAHSGAA PWQPLAAPSG ASAQAAEQLQ
510 520 530 540 550
RGPNQPVESD ESLGGLSAAL RSWHLTPSCP LDPAPLREAG CPQGPTAGES
560 570 580 590 600
SWGSGPGSRP TAVEGLALGS SASSSSEPPQ IIINPARQKM VQKLALYEDG
610 620 630
ALDSLQLLSS SSLPGLGLEQ DRQGPEESDE FQS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again