Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_G3TGL0 Uncharacterized protein n=1 Tax=Loxodonta africana TaxID=9785 RepID=G3TGL0_LOXAF MFVQEEKIFAGKVLRLHICAADGAEWLEEAAEDTSVEKLKERCLKHCAHGNLEDPKSVTH HKLIHAASERVLNDAKTILEENVQDKDVLLLIKKRAPAPLPKMADVSEEEKMKQDQTTPD RDAIFQATADLPSHNMDRAVVQTSVRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKA NAMLDEDEEERVDEAALRQLTEMGFPETRAVKALRLNHMSVTQAMEWLIEHAEDPTIDTP LPGQASPGTSEATATSTEAPTGTSEGEEEVRDELTEVFKKIRRKREFRADARAVVSLMEM GFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGMDPESPLFQAILDNPVVQLGL TNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
G3TGL0G3TGL0_LOXAFUncharacterized proteinLoxodonta africana (African elephant)9785405Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
G3TGL0

Checksumi: 6E94641133C02009

FASTA40545,518
        10         20         30         40         50
MFVQEEKIFA GKVLRLHICA ADGAEWLEEA AEDTSVEKLK ERCLKHCAHG
60 70 80 90 100
NLEDPKSVTH HKLIHAASER VLNDAKTILE ENVQDKDVLL LIKKRAPAPL
110 120 130 140 150
PKMADVSEEE KMKQDQTTPD RDAIFQATAD LPSHNMDRAV VQTSVRDFQT
160 170 180 190 200
ELRKILVSLI EVAQKLLALN PDAVELFKKA NAMLDEDEEE RVDEAALRQL
210 220 230 240 250
TEMGFPETRA VKALRLNHMS VTQAMEWLIE HAEDPTIDTP LPGQASPGTS
260 270 280 290 300
EATATSTEAP TGTSEGEEEV RDELTEVFKK IRRKREFRAD ARAVVSLMEM
310 320 330 340 350
GFDEKEVIDA LRVNNNQQNA ACEWLLGDRK PSPEELDKGM DPESPLFQAI
360 370 380 390 400
LDNPVVQLGL TNPKTLLAFE DMLENPLNST QWMNDPETGP VMLQISRIFQ

TLNRT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again