Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_H0Y4G9 Myeloid differentiation primary response protein MyD88 n=3 Tax=Homo sapiens TaxID=9606 RepID=H0Y4G9_HUMAN MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP SIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICY CPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRLARRPRGGCRRM VVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNP CTKSWFWTRLAKALSLP

Members

Expand cluster to 90% or 50% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
H0Y4G9H0Y4G9_HUMANMyeloid differentiation primary response protein MyD88Homo sapiens (Human)9606317Representative & Seed
Q99836-6Isoform 6 of MYD88_HUMAN6Homo sapiens (Human)9606304
A0A192GQD4A0A192GQD4_HUMANMyeloid differentiation primary response 88 (Fragment)Homo sapiens (Human)9606113

Sequence

Representative sequenceiLengthMass (Da)Tools
H0Y4G9

Checksumi: 11A566BE9A227EA3

FASTA31735,444
        10         20         30         40         50
MRPDRAEAPG PPAMAAGGPG AGSAAPVSST SSLPLAALNM RVRRRLSLFL
60 70 80 90 100
NVRTQVAADW TALAEEMDFE YLEIRQLETQ ADPTGRLLDA WQGRPGASVG
110 120 130 140 150
RLLELLTKLG RDDVLLELGP SIEEDCQKYI LKQQQEEAEK PLQVAAVDSS
160 170 180 190 200
VPRTAELAGI TTLDDPLGHM PERFDAFICY CPSDIQFVQE MIRQLEQTNY
210 220 230 240 250
RLKLCVSDRD VLPGTCVWSI ASELIEKRLA RRPRGGCRRM VVVVSDDYLQ
260 270 280 290 300
SKECDFQTKF ALSLSPGAHQ KRLIPIKYKA MKKEFPSILR FITVCDYTNP
310
CTKSWFWTRL AKALSLP
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again