Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_O00264 Membrane-associated progesterone receptor component 1 n=4 Tax=Homininae TaxID=207598 RepID=PGRC1_HUMAN MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDD EPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD ASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVY SDEEEPKDESARKND

Members

Expand cluster to 90% or 50% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O00264PGRC1_HUMANMembrane-associated progesterone receptor component 1Homo sapiens (Human)9606195Representative & Seed
Q6IB11Q6IB11_HUMANPGRMC1 proteinHomo sapiens (Human)9606195
K6ZK25K6ZK25_PANTRPGRMC1 isoform 2Pan troglodytes (Chimpanzee)9598195
A0A2R9CGP0A0A2R9CGP0_PANPACytochrome b5 heme-binding domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597195

Sequence

Representative sequenceiLengthMass (Da)Tools
O00264

Checksumi: CCD5E802E1C9E604

FASTA19521,671
        10         20         30         40         50
MAAEDVVATG ADPSDLESGG LLHEIFTSPL NLLLLGLCIF LLYKIVRGDQ
60 70 80 90 100
PAASGDSDDD EPPPLPRLKR RDFTPAELRR FDGVQDPRIL MAINGKVFDV
110 120 130 140 150
TKGRKFYGPE GPYGVFAGRD ASRGLATFCL DKEALKDEYD DLSDLTAAQQ
160 170 180 190
ETLSDWESQF TFKYHHVGKL LKEGEEPTVY SDEEEPKDES ARKND
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again