Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_O00567 Nucleolar protein 56 n=2 Tax=Homo sapiens TaxID=9606 RepID=NOP56_HUMAN MVLLHVLFEHAVGYALLALKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVA LENANAVSEGVVHEDLRLLLETHLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAE ILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDK DINTFSMRVREWYGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAK AKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALI GEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRA AAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDV MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPK KKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPK EETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O00567NOP56_HUMANNucleolar protein 56Homo sapiens (Human)9606594Representative & Seed
Q9BSN3Q9BSN3_HUMANNOP56 proteinHomo sapiens (Human)9606174

Sequence

Representative sequenceiLengthMass (Da)Tools
O00567

Checksumi: 17D81E25DEBD052F

FASTA59466,050
        10         20         30         40         50
MVLLHVLFEH AVGYALLALK EVEEISLLQP QVEESVLNLG KFHSIVRLVA
60 70 80 90 100
FCPFASSQVA LENANAVSEG VVHEDLRLLL ETHLPSKKKK VLLGVGDPKI
110 120 130 140 150
GAAIQEELGY NCQTGGVIAE ILRGVRLHFH NLVKGLTDLS ACKAQLGLGH
160 170 180 190 200
SYSRAKVKFN VNRVDNMIIQ SISLLDQLDK DINTFSMRVR EWYGYHFPEL
210 220 230 240 250
VKIINDNATY CRLAQFIGNR RELNEDKLEK LEELTMDGAK AKAILDASRS
260 270 280 290 300
SMGMDISAID LINIESFSSR VVSLSEYRQS LHTYLRSKMS QVAPSLSALI
310 320 330 340 350
GEAVGARLIA HAGSLTNLAK YPASTVQILG AEKALFRALK TRGNTPKYGL
360 370 380 390 400
IFHSTFIGRA AAKNKGRISR YLANKCSIAS RIDCFSEVPT SVFGEKLREQ
410 420 430 440 450
VEERLSFYET GEIPRKNLDV MKEAMVQAEE AAAEITRKLE KQEKKRLKKE
460 470 480 490 500
KKRLAALALA SSENSSSTPE ECEEMSEKPK KKKKQKPQEV PQENGMEDPS
510 520 530 540 550
ISFSKPKKKK SFSKEELMSS DLEETAGSTS IPKRKKSTPK EETVNDPEEA
560 570 580 590
GHRSGSKKKR KFSKEEPVSS GPEEAVGKSS SKKKKKFHKA SQED
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again