Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_O14641 Segment polarity protein dishevelled homolog DVL-2 n=4 Tax=Homininae TaxID=207598 RepID=DVL2_HUMAN MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPL PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTG GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRR KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRA HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS FHMAMGNPSEFFVDVM

Members

Expand cluster to 90% or 50% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O14641DVL2_HUMANSegment polarity protein dishevelled homolog DVL-2Homo sapiens (Human)9606736Representative
H2QC24H2QC24_PANTRDVL2 isoform 1Pan troglodytes (Chimpanzee)9598736
A0A2R9AFV8A0A2R9AFV8_PANPADishevelled segment polarity protein 2Pan paniscus (Pygmy chimpanzee) (Bonobo)9597736
UPI0002743BF3segment polarity protein dishevelled homolog DVL-2 isoform X1Pan paniscus (Pygmy chimpanzee) (Bonobo)9597826Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
O14641

Checksumi: 4BAD95B6C3FE531B

FASTA73678,948
        10         20         30         40         50
MAGSSTGGGG VGETKVIYHL DEEETPYLVK IPVPAERITL GDFKSVLQRP
60 70 80 90 100
AGAKYFFKSM DQDFGVVKEE ISDDNARLPC FNGRVVSWLV SSDNPQPEMA
110 120 130 140 150
PPVHEPRAEL APPAPPLPPL PPERTSGIGD SRPPSFHPNV SSSHENLEPE
160 170 180 190 200
TETESVVSLR RERPRRRDSS EHGAGGHRTG GPSRLERHLA GYESSSTLMT
210 220 230 240 250
SELESTSLGD SDEEDTMSRF SSSTEQSSAS RLLKRHRRRR KQRPPRLERT
260 270 280 290 300
SSFSSVTDST MSLNIITVTL NMEKYNFLGI SIVGQSNERG DGGIYIGSIM
310 320 330 340 350
KGGAVAADGR IEPGDMLLQV NDMNFENMSN DDAVRVLRDI VHKPGPIVLT
360 370 380 390 400
VAKCWDPSPQ AYFTLPRNEP IQPIDPAAWV SHSAALTGTF PAYPGSSSMS
410 420 430 440 450
TITSGSSLPD GCEGRGLSVH TDMASVTKAM AAPESGLEVR DRMWLKITIP
460 470 480 490 500
NAFLGSDVVD WLYHHVEGFP ERREARKYAS GLLKAGLIRH TVNKITFSEQ
510 520 530 540 550
CYYVFGDLSG GCESYLVNLS LNDNDGSSGA SDQDTLAPLP GATPWPLLPT
560 570 580 590 600
FSYQYPAPHP YSPQPPPYHE LSSYTYGGGS ASSQHSEGSR SSGSTRSDGG
610 620 630 640 650
AGRTGRPEER APESKSGSGS ESEPSSRGGS LRRGGEASGT SDGGPPPSRG
660 670 680 690 700
STGGAPNLRA HPGLHPYGPP PGMALPYNPM MVVMMPPPPP PVPPAVQPPG
710 720 730
APPVRDLGSV PPELTASRQS FHMAMGNPSE FFVDVM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again