Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_O16797 60S ribosomal protein L3 n=6 Tax=melanogaster group TaxID=32346 RepID=RL3_DROME MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREA DRPGSKINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYK NWYKSKKKAFTKASKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIKQRQKKAHV MEIQLNGGSIEDKVKWAREHLEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKKL PRKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIK NNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTKRSAL EQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLKKDRLKEEAAATTAAAAAATTTSA

Members

Expand cluster to 90% or 50% identity.
1 to 6 of 6  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O16797RL3_DROME60S ribosomal protein L3Drosophila melanogaster (Fruit fly)7227416Representative
C6SUV6C6SUV6_DROMELP14077p (Fragment)Drosophila melanogaster (Fruit fly)7227418Seed
B4QU67B4QU67_DROSIGD18739Drosophila simulans (Fruit fly)7240416
A0A4P2V7B0A0A4P2V7B0_9MUSCRibosomal protein L3 (Fragment)Drosophila pseudotakahashii193234229
A0A4P2VFG9A0A4P2VFG9_DROJARibosomal protein L3 (Fragment)Drosophila jambulina (Fruit fly)111875228
A0A4P2V781A0A4P2V781_DROAVRibosomal protein L3 (Fragment)Drosophila auraria (Fruit fly)47315228

Sequence

Representative sequenceiLengthMass (Da)Tools
O16797

Checksumi: 779D843982334AA5

FASTA41646,916
        10         20         30         40         50
MSHRKFSAPR HGSMAFYPKK RSARHRGKVK AFPKDDASKP VHLTCFIGYK
60 70 80 90 100
AGMTHIVREA DRPGSKINKK EVVEAVTVLE TPPMIVVGAV GYIETPFGLR
110 120 130 140 150
ALVNVWAQHL SEECRRRFYK NWYKSKKKAF TKASKKWTDD LGKKSIENDF
160 170 180 190 200
RKMLRYCKVI RVIAHSQIRL IKQRQKKAHV MEIQLNGGSI EDKVKWAREH
210 220 230 240 250
LEKPIQVSNV FGQDEMIDCV GVTKGKGFKG VTSRWHTKKL PRKTHKGLRK
260 270 280 290 300
VACIGAWHPS RVSTTVARAG QKGYHHRTEI NKKIYRIGAG IHTKDGKVIK
310 320 330 340 350
NNASTEYDLT DKSITPMGGF PHYGEVNNDF VMIKGCCIGS KKRIITLRKS
360 370 380 390 400
LLKHTKRSAL EQIKLKFIDT SSKMGHGRFQ TPADKLAFMG PLKKDRLKEE
410
AAATTAAAAA ATTTSA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again