Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_O43766 Lipoyl synthase, mitochondrial n=2 Tax=Homo sapiens TaxID=9606 RepID=LIAS_HUMAN MSLRCGDAARTLGPRVFGRYFCSPVRPLSSLPDKKKELLQNGPDLQDFVSGDLADRSTWD EYKGNLKRQKGERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGG GEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDASEPYNTAKAIAEWGLDYVVLTSV DRDDMPDGGAEHIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVET VPELQSKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREAD VDCLTLGQYMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFL KNLVAKRKTKDL

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
O43766LIAS_HUMANLipoyl synthase, mitochondrialHomo sapiens (Human)9606372Representative & Seed
A0A024R9W0A0A024R9W0_HUMANLipoyl synthase, mitochondrialHomo sapiens (Human)9606372

Sequence

Representative sequenceiLengthMass (Da)Tools
O43766

Checksumi: A5BEACA1F36CEB74

FASTA37241,911
        10         20         30         40         50
MSLRCGDAAR TLGPRVFGRY FCSPVRPLSS LPDKKKELLQ NGPDLQDFVS
60 70 80 90 100
GDLADRSTWD EYKGNLKRQK GERLRLPPWL KTEIPMGKNY NKLKNTLRNL
110 120 130 140 150
NLHTVCEEAR CPNIGECWGG GEYATATATI MLMGDTCTRG CRFCSVKTAR
160 170 180 190 200
NPPPLDASEP YNTAKAIAEW GLDYVVLTSV DRDDMPDGGA EHIAKTVSYL
210 220 230 240 250
KERNPKILVE CLTPDFRGDL KAIEKVALSG LDVYAHNVET VPELQSKVRD
260 270 280 290 300
PRANFDQSLR VLKHAKKVQP DVISKTSIML GLGENDEQVY ATMKALREAD
310 320 330 340 350
VDCLTLGQYM QPTRRHLKVE EYITPEKFKY WEKVGNELGF HYTASGPLVR
360 370
SSYKAGEFFL KNLVAKRKTK DL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again