Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P05050 Alpha-ketoglutarate-dependent dioxygenase AlkB n=18 Tax=Enterobacteriaceae TaxID=543 RepID=ALKB_ECOLI MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVA MTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLIN RYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGG ESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKE

Members

Expand cluster to 90% or 50% identity.
1 to 18 of 18  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P05050ALKB_ECOLIAlpha-ketoglutarate-dependent dioxygenase AlkBEscherichia coli (strain K12)83333216Representative
A0A4S5AAZ2A0A4S5AAZ2_ECOLIDNA oxidative demethylase AlkBEscherichia coli (strain K12)83333216
A0A037Y4V1A0A037Y4V1_ECOLXAlkylated DNA repair protein AlkBEscherichia coli562216
A0A235JWA1A0A235JWA1_SHISOAlpha-ketoglutarate-dependent dioxygenase AlkBShigella sonnei624216
A0A1X3JEY1A0A1X3JEY1_ECOLXAlkylated DNA repair protein AlkBEscherichia coli H386656397216
A0A069XS00A0A069XS00_ECOLXAlkylated DNA repair protein AlkBEscherichia coli 3-373-03_S4_C21444252216
I2XIJ2I2XIJ2_ECOLXAlkylated DNA repair protein AlkBEscherichia coli 2.3916869688216
E3PDR4E3PDR4_ECOH1Alpha-ketoglutarate-dependent dioxygenase (Alkylated DNA repair protein)Escherichia coli O78:H11 (strain H10407 / ETEC)316401216
F4SG55F4SG55_ECOLXAlkylated DNA repair protein AlkBEscherichia coli H736656414216
T9DR33T9DR33_ECOLXAlpha-ketoglutarate-dependent dioxygenase AlkBEscherichia coli UMEA 3212-11281218216
G0FDC5G0FDC5_ECOLXAlkylated DNA repair protein AlkBEscherichia coli UMNF181050617216
H4ULI8H4ULI8_ECOLXAlkylated DNA repair protein AlkBEscherichia coli DEC6A868160216
A0A070T6Z4A0A070T6Z4_ECOLXAlkylated DNA repair protein AlkBEscherichia coli 2-210-07_S3_C31444180216
A0A376WYR9A0A376WYR9_ECOLXAlpha-ketoglutarate-dependent dioxygenase (Alkylated DNA repair protein)Escherichia coli562160
A0A563F5E0A0A563F5E0_ECOLXDNA oxidative demethylase AlkB (Fragment)Escherichia coli56242
UPI0001C2FA99Alpha-ketoglutarate-dependent dioxygenase alkBEscherichia coli (strain K12)83333219Seed
UPI00078AF309Alpha-ketoglutarate-dependent dioxygenase AlkBEscherichia coli562203
UPI000D10BA33DNA oxidative demethylase AlkBEscherichia coli562142

Sequence

Representative sequenceiLengthMass (Da)Tools
P05050

Checksumi: 494FE1E70EABD278

FASTA21624,076
        10         20         30         40         50
MLDLFADAEP WQEPLAAGAV ILRRFAFNAA EQLIRDINDV ASQSPFRQMV
60 70 80 90 100
TPGGYTMSVA MTNCGHLGWT THRQGYLYSP IDPQTNKPWP AMPQSFHNLC
110 120 130 140 150
QRAATAAGYP DFQPDACLIN RYAPGAKLSL HQDKDEPDLR APIVSVSLGL
160 170 180 190 200
PAIFQFGGLK RNDPLKRLLL EHGDVVVWGG ESRLFYHGIQ PLKAGFHPLT
210
IDCRYNLTFR QAGKKE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again