Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P08121 Collagen alpha-1(III) chain n=9 Tax=cellular organisms TaxID=131567 RepID=CO3A1_MOUSE MMSFVQSGTWFLLTLLHPTLILAQQSNVDELGCSHLGQSYESRDVWKPEPCQICVCDSGS VLCDDIICDEEPLDCPNPEIPFGECCAICPQPSTPAPVLPDGHGPQGPKGDPGPPGIPGR NGDPGLPGQPGLPGPPGSPGICESCPTGGQNYSPQFDSYDVKSGVGGMGGYPGPAGPPGP PGPPGSSGHPGSPGSPGYQGPPGEPGQAGPAGPPGPPGALGPAGPAGKDGESGRPGRPGE RGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGDNGAPGPMGP RGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGS NGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGT NGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGA AGERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDGTPGGPGIRGMPGS PGGPGNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGG PGLPGPAGKNGETGPQGPPGPTGPAGDKGDSGPPGPQGLQGIPGTGGPPGENGKPGEPGP KGEVGAPGAPGGKGDSGAPGERGPPGTAGIPGARGGAGPPGPEGGKGPAGPPGPPGASGS PGLQGMPGERGGPGSPGPKGEKGEPGGAGADGVPGKDGPRGPAGPIGPPGPAGQPGDKGE GGSPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGP AGPTGSSGPAGPPGPQGVKGERGSPGGPGTAGFPGGRGLPGPPGNNGNPGPPGPSGAPGK DGPPGPAGNSGSPGNPGIAGPKGDAGQPGEKGPPGAQGPPGSPGPLGIAGLTGARGLAGP PGMPGPRGSPGPQGIKGESGKPGASGHNGERGPPGPQGLPGQPGTAGEPGRDGNPGSDGQ PGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPSGKSGDRGETGPAGPSGAPGPAGA RGAPGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGAAGHQGAIGSPGPAGPRGP VGPHGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGGA AAIAGVGGEKSGGFSPYYGDDPMDFKINTEEIMSSLKSVNGQIESLISPDGSRKNPARNC RDLKFCHPELKSGEYWVDPNQGCKMDAIKVFCNMETGETCINASPMTVPRKHWWTDSGAE KKHVWFGESMNGGFQFSYGPPDLPEDVVDVQLAFLRLLSSRASQNITYHCKNSIAYMDQA SGNVKKSLKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYQTRKAMRLPII DIAPYDIGGPDQEFGVDIGPVCFL

Members

Expand cluster to 90% or 50% identity.
1 to 9 of 9  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P08121CO3A1_MOUSECollagen alpha-1(III) chainMus musculus (Mouse)100901,464Representative
Q5DTG2Q5DTG2_MOUSEMKIAA4231 protein (Fragment)Mus musculus (Mouse)100901,467Seed
Q3TVI5Q3TVI5_MOUSEProcollagen, type III, alpha 1Mus musculus (Mouse)100901,464
Q9CSB7Q9CSB7_MOUSEVWFC domain-containing protein (Fragment)Mus musculus (Mouse)10090292
Q8BMR6Q8BMR6_MOUSEFibrillar collagen NC1 domain-containing protein (Fragment)Mus musculus (Mouse)10090218
A0A4R4GQ68A0A4R4GQ68_9GAMMCollagen-like protein (Fragment)Halomonas sp. 204254609595
A1DYC5A1DYC5_VICPAProcollagen type III alpha 1 (Fragment)Vicugna pacos (Alpaca) (Lama pacos)3053873
Q8BJU6Q8BJU6_MOUSEFibrillar collagen NC1 domain-containing protein (Fragment)Mus musculus (Mouse)10090338
A0A4R4GN50A0A4R4GN50_9GAMMUncharacterized protein (Fragment)Halomonas sp. 204254609591

Sequence

Representative sequenceiLengthMass (Da)Tools
P08121

Checksumi: 2104EC27A886090B

FASTA1,464138,943
        10         20         30         40         50
MMSFVQSGTW FLLTLLHPTL ILAQQSNVDE LGCSHLGQSY ESRDVWKPEP
60 70 80 90 100
CQICVCDSGS VLCDDIICDE EPLDCPNPEI PFGECCAICP QPSTPAPVLP
110 120 130 140 150
DGHGPQGPKG DPGPPGIPGR NGDPGLPGQP GLPGPPGSPG ICESCPTGGQ
160 170 180 190 200
NYSPQFDSYD VKSGVGGMGG YPGPAGPPGP PGPPGSSGHP GSPGSPGYQG
210 220 230 240 250
PPGEPGQAGP AGPPGPPGAL GPAGPAGKDG ESGRPGRPGE RGLPGPPGIK
260 270 280 290 300
GPAGMPGFPG MKGHRGFDGR NGEKGETGAP GLKGENGLPG DNGAPGPMGP
310 320 330 340 350
RGAPGERGRP GLPGAAGARG NDGARGSDGQ PGPPGPPGTA GFPGSPGAKG
360 370 380 390 400
EVGPAGSPGS NGSPGQRGEP GPQGHAGAQG PPGPPGNNGS PGGKGEMGPA
410 420 430 440 450
GIPGAPGLIG ARGPPGPAGT NGIPGTRGPS GEPGKNGAKG EPGARGERGE
460 470 480 490 500
AGSPGIPGPK GEDGKDGSPG EPGANGLPGA AGERGPSGFR GPAGPNGIPG
510 520 530 540 550
EKGPPGERGG PGPAGPRGVA GEPGRDGTPG GPGIRGMPGS PGGPGNDGKP
560 570 580 590 600
GPPGSQGESG RPGPPGPSGP RGQPGVMGFP GPKGNDGAPG KNGERGGPGG
610 620 630 640 650
PGLPGPAGKN GETGPQGPPG PTGPAGDKGD SGPPGPQGLQ GIPGTGGPPG
660 670 680 690 700
ENGKPGEPGP KGEVGAPGAP GGKGDSGAPG ERGPPGTAGI PGARGGAGPP
710 720 730 740 750
GPEGGKGPAG PPGPPGASGS PGLQGMPGER GGPGSPGPKG EKGEPGGAGA
760 770 780 790 800
DGVPGKDGPR GPAGPIGPPG PAGQPGDKGE GGSPGLPGIA GPRGGPGERG
810 820 830 840 850
EHGPPGPAGF PGAPGQNGEP GAKGERGAPG EKGEGGPPGP AGPTGSSGPA
860 870 880 890 900
GPPGPQGVKG ERGSPGGPGT AGFPGGRGLP GPPGNNGNPG PPGPSGAPGK
910 920 930 940 950
DGPPGPAGNS GSPGNPGIAG PKGDAGQPGE KGPPGAQGPP GSPGPLGIAG
960 970 980 990 1000
LTGARGLAGP PGMPGPRGSP GPQGIKGESG KPGASGHNGE RGPPGPQGLP
1010 1020 1030 1040 1050
GQPGTAGEPG RDGNPGSDGQ PGRDGSPGGK GDRGENGSPG APGAPGHPGP
1060 1070 1080 1090 1100
PGPVGPSGKS GDRGETGPAG PSGAPGPAGA RGAPGPQGPR GDKGETGERG
1110 1120 1130 1140 1150
SNGIKGHRGF PGNPGPPGSP GAAGHQGAIG SPGPAGPRGP VGPHGPPGKD
1160 1170 1180 1190 1200
GTSGHPGPIG PPGPRGNRGE RGSEGSPGHP GQPGPPGPPG APGPCCGGGA
1210 1220 1230 1240 1250
AAIAGVGGEK SGGFSPYYGD DPMDFKINTE EIMSSLKSVN GQIESLISPD
1260 1270 1280 1290 1300
GSRKNPARNC RDLKFCHPEL KSGEYWVDPN QGCKMDAIKV FCNMETGETC
1310 1320 1330 1340 1350
INASPMTVPR KHWWTDSGAE KKHVWFGESM NGGFQFSYGP PDLPEDVVDV
1360 1370 1380 1390 1400
QLAFLRLLSS RASQNITYHC KNSIAYMDQA SGNVKKSLKL MGSNEGEFKA
1410 1420 1430 1440 1450
EGNSKFTYTV LEDGCTKHTG EWSKTVFEYQ TRKAMRLPII DIAPYDIGGP
1460
DQEFGVDIGP VCFL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again