Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P10644 cAMP-dependent protein kinase type I-alpha regulatory subunit n=10 Tax=Hominoidea TaxID=314295 RepID=KAP0_HUMAN MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG PCSDILKRNIQQYNSFVSLSV

Members

Expand cluster to 90% or 50% identity.
1 to 10 of 10  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P10644KAP0_HUMANcAMP-dependent protein kinase type I-alpha regulatory subunitHomo sapiens (Human)9606381Representative & Seed
Q5REL1KAP0_PONABcAMP-dependent protein kinase type I-alpha regulatory subunitPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601381
B2R5T5B2R5T5_HUMANEpididymis secretory sperm binding proteinHomo sapiens (Human)9606381
H2R3M7H2R3M7_PANTRPRKAR1A isoform 12Pan troglodytes (Chimpanzee)9598381
A0A2J8V090A0A2J8V090_PONABPRKAR1A isoform 16Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601381
A0A2R9AQD9A0A2R9AQD9_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597381
A0A2I3HG51A0A2I3HG51_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853381
K7EPB2K7EPB2_HUMANcAMP-dependent protein kinase type I-alpha regulatory subunit (Fragment)Homo sapiens (Human)9606297
A0A2J8V091A0A2J8V091_PONABPRKAR1A isoform 13 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601297
A0A2J8KKN0A0A2J8KKN0_PANTRPRKAR1A isoform 13 (Fragment)Pan troglodytes (Chimpanzee)9598297

Sequence

Representative sequenceiLengthMass (Da)Tools
P10644

Checksumi: 2D04F08CE8857A6D

FASTA38142,982
        10         20         30         40         50
MESGSTAASE EARSLRECEL YVQKHNIQAL LKDSIVQLCT ARPERPMAFL
60 70 80 90 100
REYFERLEKE EAKQIQNLQK AGTRTDSRED EISPPPPNPV VKGRRRRGAI
110 120 130 140 150
SAEVYTEEDA ASYVRKVIPK DYKTMAALAK AIEKNVLFSH LDDNERSDIF
160 170 180 190 200
DAMFSVSFIA GETVIQQGDE GDNFYVIDQG ETDVYVNNEW ATSVGEGGSF
210 220 230 240 250
GELALIYGTP RAATVKAKTN VKLWGIDRDS YRRILMGSTL RKRKMYEEFL
260 270 280 290 300
SKVSILESLD KWERLTVADA LEPVQFEDGQ KIVVQGEPGD EFFIILEGSA
310 320 330 340 350
AVLQRRSENE EFVEVGRLGP SDYFGEIALL MNRPRAATVV ARGPLKCVKL
360 370 380
DRPRFERVLG PCSDILKRNI QQYNSFVSLS V
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again