Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P11440 Cyclin-dependent kinase 1 n=3 Tax=Mus musculus TaxID=10090 RepID=CDK1_MOUSE MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRH PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCH SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM

Members

Expand cluster to 90% or 50% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P11440CDK1_MOUSECyclin-dependent kinase 1Mus musculus (Mouse)10090297Representative & Seed
D3Z2T9D3Z2T9_MOUSECyclin-dependent kinase 1 (Fragment)Mus musculus (Mouse)10090200
Q8R4A4Q8R4A4_MOUSECell cycle p34 CDC2 kinase protein (Fragment)Mus musculus (Mouse)10090191

Sequence

Representative sequenceiLengthMass (Da)Tools
P11440

Checksumi: 9C399FCC41BA7F31

FASTA29734,107
        10         20         30         40         50
MEDYIKIEKI GEGTYGVVYK GRHRVTGQIV AMKKIRLESE EEGVPSTAIR
60 70 80 90 100
EISLLKELRH PNIVSLQDVL MQDSRLYLIF EFLSMDLKKY LDSIPPGQFM
110 120 130 140 150
DSSLVKSYLH QILQGIVFCH SRRVLHRDLK PQNLLIDDKG TIKLADFGLA
160 170 180 190 200
RAFGIPIRVY THEVVTLWYR SPEVLLGSAR YSTPVDIWSI GTIFAELATK
210 220 230 240 250
KPLFHGDSEI DQLFRIFRAL GTPNNEVWPE VESLQDYKNT FPKWKPGSLA
260 270 280 290
SHVKNLDENG LDLLSKMLVY DPAKRISGKM ALKHPYFDDL DNQIKKM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again