Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P15941-16 Isoform E2 of Mucin-1 n=1 Tax=Homo sapiens TaxID=9606 RepID=Isoform 16 of MUC1_HUMAN MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEK NASGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEY PTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

Members

Expand cluster to 90% or 50% identity.
1 to 1 of 1  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P15941-16Isoform 16 of MUC1_HUMANE2Homo sapiens (Human)9606166Representative & Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
P15941-16

Checksumi: BF6C969984986AD0

FASTA16617,287
        10         20         30         40         50
MTPGTQSPFF LLLLLTVLTA TTAPKPATVV TGSGHASSTP GGEKETSATQ
60 70 80 90 100
RSSVPSSTEK NASGAGVPGW GIALLVLVCV LVALAIVYLI ALAVCQCRRK
110 120 130 140 150
NYGQLDIFPA RDTYHPMSEY PTYHTHGRYV PPSSTDRSPY EKVSAGNGGS
160
SLSYTNPAVA ATSANL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again