Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P16104 Histone H2AX n=17 Tax=Simiiformes TaxID=314293 RepID=H2AX_HUMAN MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPSGGKKATQASQEY

Members

Expand cluster to 90% or 50% identity.
1 to 17 of 17  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P16104H2AX_HUMANHistone H2AXHomo sapiens (Human)9606143Representative & Seed
U3CDD7U3CDD7_CALJAHistone H2ACallithrix jacchus (White-tufted-ear marmoset)9483143
K6ZAK5K6ZAK5_PANTRHistone H2APan troglodytes (Chimpanzee)9598143
A0A1D5Q5B3A0A1D5Q5B3_MACMUHistone H2AMacaca mulatta (Rhesus macaque)9544143
G7PPA0G7PPA0_MACFAHistone H2AMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541143
A0A2J8X0N8A0A2J8X0N8_PONABHistone H2APongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601143
A0A2K6S5E4A0A2K6S5E4_SAIBBHistone H2ASaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432143
A0A2K5PE66A0A2K5PE66_CEBCAHistone H2ACebus capucinus imitator1737458143
A0A2K5HE74A0A2K5HE74_COLAPHistone H2AColobus angolensis palliatus (Peters' Angolan colobus)336983143
A0A2K5KXP0A0A2K5KXP0_CERATHistone H2ACercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531143
A0A2K6N9R8A0A2K6N9R8_RHIROHistone H2ARhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622143
A0A096N7R2A0A096N7R2_PAPANHistone H2APapio anubis (Olive baboon)9555143
A0A0D9S972A0A0D9S972_CHLSBHistone H2AChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711143
A0A2K5XDM8A0A2K5XDM8_MANLEHistone H2AMandrillus leucophaeus (Drill) (Papio leucophaeus)9568143
G3QYE9G3QYE9_GORGOHistone H2AGorilla gorilla gorilla (Western lowland gorilla)9595143
A0A2K6JYN0A0A2K6JYN0_RHIBEHistone H2ARhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621143
A0A2K6AZQ4A0A2K6AZQ4_MACNEHistone H2AMacaca nemestrina (Pig-tailed macaque)9545143

Sequence

Representative sequenceiLengthMass (Da)Tools
P16104

Checksumi: D4683775C2E6C3A9

FASTA14315,145
        10         20         30         40         50
MSGRGKTGGK ARAKAKSRSS RAGLQFPVGR VHRLLRKGHY AERVGAGAPV
60 70 80 90 100
YLAAVLEYLT AEILELAGNA ARDNKKTRII PRHLQLAIRN DEELNKLLGG
110 120 130 140
VTIAQGGVLP NIQAVLLPKK TSATVGPKAP SGGKKATQAS QEY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again