Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P24001 Interleukin-32 n=3 Tax=Homo sapiens TaxID=9606 RepID=IL32_HUMAN MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV VALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK

Members

Expand cluster to 90% or 50% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P24001IL32_HUMANInterleukin-32Homo sapiens (Human)9606234Representative & Seed
F8VSD2F8VSD2_HUMANInterleukin-32 (Fragment)Homo sapiens (Human)9606225
C6GKH2C6GKH2_HUMANInterleukin-32 smallHomo sapiens (Human)960680

Sequence

Representative sequenceiLengthMass (Da)Tools
P24001

Checksumi: 5F339FE2D348A761

FASTA23426,676
        10         20         30         40         50
MCFPKVLSDD MKKLKARMVM LLPTSAQGLG AWVSACDTED TVGHLGPWRD
60 70 80 90 100
KDPALWCQLC LSSQHQAIER FYDKMQNAES GRGQVMSSLA ELEDDFKEGY
110 120 130 140 150
LETVAAYYEE QHPELTPLLE KERDGLRCRG NRSPVPDVED PATEEPGESF
160 170 180 190 200
CDKVMRWFQA MLQRLQTWWH GVLAWVKEKV VALVHAVQAL WKQFQSFCCS
210 220 230
LSELFMSSFQ SYGAPRGDKE ELTPQKCSEP QSSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again