Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P25786-2 Isoform Long of Proteasome subunit alpha type-1 n=13 Tax=Catarrhini TaxID=9526 RepID=Isoform 2 of PSA1_HUMAN MQLSKVKFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQS ELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGS KTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLER HMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLE GLEERPQRKAQPAQPADEPAEKADEPMEH

Members

Expand cluster to 90% or 50% identity.
1 to 13 of 13  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P25786-2Isoform 2 of PSA1_HUMANLongHomo sapiens (Human)9606269Representative
F7GF95F7GF95_MACMUProteasome subunit alpha typeMacaca mulatta (Rhesus macaque)9544269Seed
A0A2K5I436A0A2K5I436_COLAPProteasome subunit alpha typeColobus angolensis palliatus (Peters' Angolan colobus)336983269
H2Q378H2Q378_PANTRProteasome subunit alpha typePan troglodytes (Chimpanzee)9598269
A0A2K5KTS3A0A2K5KTS3_CERATProteasome subunit alpha typeCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531269
A0A2K6QGK4A0A2K6QGK4_RHIROProteasome subunit alpha typeRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622269
A0A2I3LG13A0A2I3LG13_PAPANProteasome subunit alpha typePapio anubis (Olive baboon)9555269
A0A2K5YBE5A0A2K5YBE5_MANLEProteasome subunit alpha typeMandrillus leucophaeus (Drill) (Papio leucophaeus)9568269
G3QGE3G3QGE3_GORGOProteasome subunit alpha typeGorilla gorilla gorilla (Western lowland gorilla)9595269
A0A2K5W387A0A2K5W387_MACFAProteasome subunit alpha typeMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541269
A0A2K6LVA4A0A2K6LVA4_RHIBEProteasome subunit alpha typeRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621269
A0A2K6APR4A0A2K6APR4_MACNEProteasome subunit alpha typeMacaca nemestrina (Pig-tailed macaque)9545269
UPI000877AFB3Proteasome subunit alpha type-1Homo sapiens (Human)9606268

Sequence

Representative sequenceiLengthMass (Da)Tools
P25786-2

Checksumi: DB7435F82890F923

FASTA26930,239
        10         20         30         40         50
MQLSKVKFRN QYDNDVTVWS PQGRIHQIEY AMEAVKQGSA TVGLKSKTHA
60 70 80 90 100
VLVALKRAQS ELAAHQKKIL HVDNHIGISI AGLTADARLL CNFMRQECLD
110 120 130 140 150
SRFVFDRPLP VSRLVSLIGS KTQIPTQRYG RRPYGVGLLI AGYDDMGPHI
160 170 180 190 200
FQTCPSANYF DCRAMSIGAR SQSARTYLER HMSEFMECNL NELVKHGLRA
210 220 230 240 250
LRETLPAEQD LTTKNVSIGI VGKDLEFTIY DDDDVSPFLE GLEERPQRKA
260
QPAQPADEPA EKADEPMEH
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again