Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P28482 Mitogen-activated protein kinase 1 n=17 Tax=Boreoeutheria TaxID=1437010 RepID=MK01_HUMAN MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Members

Expand cluster to 90% or 50% identity.
1 to 17 of 17  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P28482MK01_HUMANMitogen-activated protein kinase 1Homo sapiens (Human)9606360Representative
Q1HBJ4Q1HBJ4_HUMANMitogen-activated protein kinaseHomo sapiens (Human)9606360
F7ECR3F7ECR3_MACMUMitogen-activated protein kinaseMacaca mulatta (Rhesus macaque)9544360
H2QLB4H2QLB4_PANTRMitogen-activated protein kinasePan troglodytes (Chimpanzee)9598360
F7AKA7F7AKA7_CALJAMitogen-activated protein kinaseCallithrix jacchus (White-tufted-ear marmoset)9483360
A0A2Y9IWM6A0A2Y9IWM6_ENHLUMitogen-activated protein kinaseEnhydra lutris kenyoni391180360
A0A2K5LSN3A0A2K5LSN3_CERATMitogen-activated protein kinaseCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531360
A0A2I3LQV7A0A2I3LQV7_PAPANMitogen-activated protein kinasePapio anubis (Olive baboon)9555360
A0A3Q7PBC8A0A3Q7PBC8_CALURMitogen-activated protein kinaseCallorhinus ursinus (Northern fur seal)34884360
A0A0D9RMI9A0A0D9RMI9_CHLSBMitogen-activated protein kinaseChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711360
E2R2N2E2R2N2_CANLFMitogen-activated protein kinaseCanis lupus familiaris (Dog) (Canis familiaris)9615360
A0A2K5TXB4A0A2K5TXB4_MACFAMitogen-activated protein kinaseMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541360
A0A3Q7UU47A0A3Q7UU47_URSARMitogen-activated protein kinaseUrsus arctos horribilis116960360
A0A2K6GUF3A0A2K6GUF3_PROCOMitogen-activated protein kinasePropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532360
A0A2K5QFC4A0A2K5QFC4_CEBCAMitogen-activated protein kinaseCebus capucinus imitator1737458360
A0A2U3VYF5A0A2U3VYF5_ODOROMitogen-activated protein kinaseOdobenus rosmarus divergens (Pacific walrus)9708360
UPI0000F0A51AMitogen-activated protein kinase 1Homo sapiens (Human)9606380Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
P28482

Checksumi: E85D0B2A5D2D724E

FASTA36041,390
        10         20         30         40         50
MAAAAAAGAG PEMVRGQVFD VGPRYTNLSY IGEGAYGMVC SAYDNVNKVR
60 70 80 90 100
VAIKKISPFE HQTYCQRTLR EIKILLRFRH ENIIGINDII RAPTIEQMKD
110 120 130 140 150
VYIVQDLMET DLYKLLKTQH LSNDHICYFL YQILRGLKYI HSANVLHRDL
160 170 180 190 200
KPSNLLLNTT CDLKICDFGL ARVADPDHDH TGFLTEYVAT RWYRAPEIML
210 220 230 240 250
NSKGYTKSID IWSVGCILAE MLSNRPIFPG KHYLDQLNHI LGILGSPSQE
260 270 280 290 300
DLNCIINLKA RNYLLSLPHK NKVPWNRLFP NADSKALDLL DKMLTFNPHK
310 320 330 340 350
RIEVEQALAH PYLEQYYDPS DEPIAEAPFK FDMELDDLPK EKLKELIFEE
360
TARFQPGYRS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again