Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P40818 Ubiquitin carboxyl-terminal hydrolase 8 n=12 Tax=Hominidae TaxID=9604 RepID=UBP8_HUMAN MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAY VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRK KLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEK GAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLP DDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGG YENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDE NIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEE HRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEK ELRERQQEEQKEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKET SAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSG KPFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLD PITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSP DITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLR NLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDH LDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTS KCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRW KQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRW FKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT

Members

Expand cluster to 90% or 50% identity.
1 to 12 of 12  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P40818UBP8_HUMANUbiquitin carboxyl-terminal hydrolase 8Homo sapiens (Human)96061,118Representative & Seed
A0A024R5S4A0A024R5S4_HUMANUbiquitin specific peptidase 8, isoform CRA_aHomo sapiens (Human)96061,118
A0A075B720A0A075B720_HUMANUbiquitin carboxyl-terminal hydrolase 8Homo sapiens (Human)9606480
H0YNL5H0YNL5_HUMANUbiquitin carboxyl-terminal hydrolase 8 (Fragment)Homo sapiens (Human)9606135
A0A2J8VBL8A0A2J8VBL8_PONABUSP8 isoform 1 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601229
A0A2J8NT03A0A2J8NT03_PANTRUSP8 isoform 13 (Fragment)Pan troglodytes (Chimpanzee)9598229
H0YM17H0YM17_HUMANUbiquitin carboxyl-terminal hydrolase 8 (Fragment)Homo sapiens (Human)960673
A0A2J8VBK8A0A2J8VBK8_PONABUSP8 isoform 11 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)960173
A0A2J8NT00A0A2J8NT00_PANTRUSP8 isoform 19 (Fragment)Pan troglodytes (Chimpanzee)959873
A0A2R8ZGH1A0A2R8ZGH1_PANPAUbiquitin specific peptidase 8Pan paniscus (Pygmy chimpanzee) (Bonobo)9597331
H0YLH2H0YLH2_HUMANUbiquitin carboxyl-terminal hydrolase 8 (Fragment)Homo sapiens (Human)960696
UPI0007DC518Aubiquitin carboxyl-terminal hydrolase 8 isoform X3Homo sapiens (Human)9606928

Sequence

Representative sequenceiLengthMass (Da)Tools
P40818

Checksumi: 8B884B7A842F9A9A

FASTA1,118127,523
        10         20         30         40         50
MPAVASVPKE LYLSSSLKDL NKKTEVKPEK ISTKSYVHSA LKIFKTAEEC
60 70 80 90 100
RLDRDEERAY VLYMKYVTVY NLIKKRPDFK QQQDYFHSIL GPGNIKKAVE
110 120 130 140 150
EAERLSESLK LRYEEAEVRK KLEEKDRQEE AQRLQQKRQE TGREDGGTLA
160 170 180 190 200
KGSLENVLDS KDKTQKSNGE KNEKCETKEK GAITAKELYT MMTDKNISLI
210 220 230 240 250
IMDARRMQDY QDSCILHSLS VPEEAISPGV TASWIEAHLP DDSKDTWKKR
260 270 280 290 300
GNVEYVVLLD WFSSAKDLQI GTTLRSLKDA LFKWESKTVL RNEPLVLEGG
310 320 330 340 350
YENWLLCYPQ YTTNAKVTPP PRRQNEEVSI SLDFTYPSLE ESIPSKPAAQ
360 370 380 390 400
TPPASIEVDE NIELISGQNE RMGPLNISTP VEPVAASKSD VSPIIQPVPS
410 420 430 440 450
IKNVPQIDRT KKPAVKLPEE HRIKSESTNH EQQSPQSGKV IPDRSTKPVV
460 470 480 490 500
FSPTLMLTDE EKARIHAETA LLMEKNKQEK ELRERQQEEQ KEKLRKEEQE
510 520 530 540 550
QKAKKKQEAE ENEITEKQQK AKEEMEKKES EQAKKEDKET SAKRGKEITG
560 570 580 590 600
VKRQSKSEHE TSDAKKSVED RGKRCPTPEI QKKSTGDVPH TSVTGDSGSG
610 620 630 640 650
KPFKIKGQPE SGILRTGTFR EDTDDTERNK AQREPLTRAR SEEMGRIVPG
660 670 680 690 700
LPSGWAKFLD PITGTFRYYH SPTNTVHMYP PEMAPSSAPP STPPTHKAKP
710 720 730 740 750
QIPAERDREP SKLKRSYSSP DITQAIQEEE KRKPTVTPTV NRENKPTCYP
760 770 780 790 800
KAEISRLSAS QIRNLNPVFG GSGPALTGLR NLGNTCYMNS ILQCLCNAPH
810 820 830 840 850
LADYFNRNCY QDDINRSNLL GHKGEVAEEF GIIMKALWTG QYRYISPKDF
860 870 880 890 900
KITIGKINDQ FAGYSQQDSQ ELLLFLMDGL HEDLNKADNR KRYKEENNDH
910 920 930 940 950
LDDFKAAEHA WQKHKQLNES IIVALFQGQF KSTVQCLTCH KKSRTFEAFM
960 970 980 990 1000
YLSLPLASTS KCTLQDCLRL FSKEEKLTDN NRFYCSHCRA RRDSLKKIEI
1010 1020 1030 1040 1050
WKLPPVLLVH LKRFSYDGRW KQKLQTSVDF PLENLDLSQY VIGPKNNLKK
1060 1070 1080 1090 1100
YNLFSVSNHY GGLDGGHYTA YCKNAARQRW FKFDDHEVSD ISVSSVKSSA
1110
AYILFYTSLG PRVTDVAT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again