Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P41240 Tyrosine-protein kinase CSK n=14 Tax=Catarrhini TaxID=9526 RepID=CSK_HUMAN MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK NCWHLDAAMRPSFLQLREQLEHIKTHELHL

Members

Expand cluster to 90% or 50% identity.
1 to 14 of 14  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P41240CSK_HUMANTyrosine-protein kinase CSKHomo sapiens (Human)9606450Representative & Seed
B2R6Q4B2R6Q4_HUMANTyrosine-protein kinaseHomo sapiens (Human)9606450
A0A2J8UDB0A0A2J8UDB0_PONABTyrosine-protein kinasePongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601450
K7AWV1K7AWV1_PANTRTyrosine-protein kinasePan troglodytes (Chimpanzee)9598450
A0A2K6RA36A0A2K6RA36_RHIROTyrosine-protein kinaseRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622450
A0A2K5LNH2A0A2K5LNH2_CERATTyrosine-protein kinaseCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531450
A0A096NMR6A0A096NMR6_PAPANTyrosine-protein kinasePapio anubis (Olive baboon)9555450
A0A2R9A3Q5A0A2R9A3Q5_PANPATyrosine-protein kinasePan paniscus (Pygmy chimpanzee) (Bonobo)9597450
A0A0D9RP44A0A0D9RP44_CHLSBTyrosine-protein kinaseChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711450
A0A2K5Z104A0A2K5Z104_MANLETyrosine-protein kinaseMandrillus leucophaeus (Drill) (Papio leucophaeus)9568450
G3R6C9G3R6C9_GORGOTyrosine-protein kinaseGorilla gorilla gorilla (Western lowland gorilla)9595450
A0A2K6K9Z4A0A2K6K9Z4_RHIBETyrosine-protein kinaseRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621450
B4DMZ0B4DMZ0_HUMANTyrosine-protein kinaseHomo sapiens (Human)9606371
UPI000181D3B9Tyrosine-protein kinase CSKHomo sapiens (Human)9606263

Sequence

Representative sequenceiLengthMass (Da)Tools
P41240

Checksumi: 431023A88C54E00C

FASTA45050,704
        10         20         30         40         50
MSAIQAAWPS GTECIAKYNF HGTAEQDLPF CKGDVLTIVA VTKDPNWYKA
60 70 80 90 100
KNKVGREGII PANYVQKREG VKAGTKLSLM PWFHGKITRE QAERLLYPPE
110 120 130 140 150
TGLFLVREST NYPGDYTLCV SCDGKVEHYR IMYHASKLSI DEEVYFENLM
160 170 180 190 200
QLVEHYTSDA DGLCTRLIKP KVMEGTVAAQ DEFYRSGWAL NMKELKLLQT
210 220 230 240 250
IGKGEFGDVM LGDYRGNKVA VKCIKNDATA QAFLAEASVM TQLRHSNLVQ
260 270 280 290 300
LLGVIVEEKG GLYIVTEYMA KGSLVDYLRS RGRSVLGGDC LLKFSLDVCE
310 320 330 340 350
AMEYLEGNNF VHRDLAARNV LVSEDNVAKV SDFGLTKEAS STQDTGKLPV
360 370 380 390 400
KWTAPEALRE KKFSTKSDVW SFGILLWEIY SFGRVPYPRI PLKDVVPRVE
410 420 430 440 450
KGYKMDAPDG CPPAVYEVMK NCWHLDAAMR PSFLQLREQL EHIKTHELHL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again