Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P43628 Killer cell immunoglobulin-like receptor 2DL3 n=4 Tax=Homo sapiens TaxID=9606 RepID=KI2L3_HUMAN MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP

Members

Expand cluster to 90% or 50% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P43628KI2L3_HUMANKiller cell immunoglobulin-like receptor 2DL3Homo sapiens (Human)9606341Representative & Seed
E3NZD8E3NZD8_HUMANKIR2DL3Homo sapiens (Human)9606341
C6EVR7C6EVR7_HUMANKIR2DL3 (Fragment)Homo sapiens (Human)9606337
M4NBK9M4NBK9_HUMANKIR2DL3 (Fragment)Homo sapiens (Human)9606273

Sequence

Representative sequenceiLengthMass (Da)Tools
P43628

Checksumi: C21EAFF80EA9AAB2

FASTA34137,886
        10         20         30         40         50
MSLMVVSMVC VGFFLLQGAW PHEGVHRKPS LLAHPGPLVK SEETVILQCW
60 70 80 90 100
SDVRFQHFLL HREGKFKDTL HLIGEHHDGV SKANFSIGPM MQDLAGTYRC
110 120 130 140 150
YGSVTHSPYQ LSAPSDPLDI VITGLYEKPS LSAQPGPTVL AGESVTLSCS
160 170 180 190 200
SRSSYDMYHL SREGEAHERR FSAGPKVNGT FQADFPLGPA THGGTYRCFG
210 220 230 240 250
SFRDSPYEWS NSSDPLLVSV TGNPSNSWPS PTEPSSETGN PRHLHVLIGT
260 270 280 290 300
SVVIILFILL LFFLLHRWCC NKKNAVVMDQ EPAGNRTVNR EDSDEQDPQE
310 320 330 340
VTYAQLNHCV FTQRKITRPS QRPKTPPTDI IVYTELPNAE P
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again