Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P46527 Cyclin-dependent kinase inhibitor 1B n=9 Tax=Hominidae TaxID=9604 RepID=CDN1B_HUMAN MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN AGSVEQTPKKPGLRRRQT

Members

Expand cluster to 90% or 50% identity.
1 to 9 of 9  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P46527CDN1B_HUMANCyclin-dependent kinase inhibitor 1BHomo sapiens (Human)9606198Representative
Q6I9V6Q6I9V6_HUMANCDKN1B proteinHomo sapiens (Human)9606198
H2NGN0H2NGN0_PONABCDKN1B isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601198
H2Q5H2H2Q5H2_PANTRCDKN1B isoform 1Pan troglodytes (Chimpanzee)9598198
A0A2R9A797A0A2R9A797_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597198
G3SDA9G3SDA9_GORGOUncharacterized proteinGorilla gorilla gorilla (Western lowland gorilla)9595198
Q9UH60Q9UH60_HUMANCyclin-dependent kinase inhibitor p27 (Fragment)Homo sapiens (Human)960642
B4DPH2B4DPH2_HUMANcDNA FLJ51923, highly similar to Cyclin-dependent kinase inhibitor 1BHomo sapiens (Human)9606147
UPI000B549554Cyclin-dependent kinase inhibitor 1BHomo sapiens (Human)9606201Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
P46527

Checksumi: 1118D58901CDF3FC

FASTA19822,073
        10         20         30         40         50
MSNVRVSNGS PSLERMDARQ AEHPKPSACR NLFGPVDHEE LTRDLEKHCR
60 70 80 90 100
DMEEASQRKW NFDFQNHKPL EGKYEWQEVE KGSLPEFYYR PPRPPKGACK
110 120 130 140 150
VPAQESQDVS GSRPAAPLIG APANSEDTHL VDPKTDPSDS QTGLAEQCAG
160 170 180 190
IRKRPATDDS STQNKRANRT EENVSDGSPN AGSVEQTPKK PGLRRRQT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again