Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P49459 Ubiquitin-conjugating enzyme E2 A n=127 Tax=Gnathostomata TaxID=7776 RepID=UBE2A_HUMAN MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFT EEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS PANSQAAQLYQENKREYEKRVSAIVEQSWRDC

Members

Expand cluster to 90% or 50% identity.
1 to 25 of 127  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P49459UBE2A_HUMANUbiquitin-conjugating enzyme E2 AHomo sapiens (Human)9606152Representative
Q9Z255UBE2A_MOUSEUbiquitin-conjugating enzyme E2 AMus musculus (Mouse)10090152
A0A4X1W626A0A4X1W626_PIGUBIQUITIN_CONJUGAT_2 domain-containing proteinSus scrofa (Pig)9823318Seed
Q9N1X5Q9N1X5_BOVINRAD6 homolog (Fragment)Bos taurus (Bovine)9913124
H2PWL6H2PWL6_PONABUBE2A isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601152
F6SPE3F6SPE3_CALJAUbiquitin-conjugating enzyme E2 A isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483152
H2QZ18H2QZ18_PANTRUBE2A isoform 1Pan troglodytes (Chimpanzee)9598152
H9FZA1H9FZA1_MACMUUbiquitin-conjugating enzyme E2 A isoform 1Macaca mulatta (Rhesus macaque)9544152
A0A2K6RLE9A0A2K6RLE9_RHIROUBIQUITIN_CONJUGAT_2 domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622152
A0A3Q1N1X1A0A3Q1N1X1_BOVINUbiquitin conjugating enzyme E2 ABos taurus (Bovine)9913152
H0XVY9H0XVY9_OTOGAUBIQUITIN_CONJUGAT_2 domain-containing proteinOtolemur garnettii (Small-eared galago) (Garnett's greater bushbaby)30611152
A0A2Y9KSP4A0A2Y9KSP4_ENHLUubiquitin-conjugating enzyme E2 A isoform X1Enhydra lutris kenyoni391180152
A0A2K5KSV1A0A2K5KSV1_CERATUBIQUITIN_CONJUGAT_2 domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531152
A0A2U3YD12A0A2U3YD12_LEPWEubiquitin-conjugating enzyme E2 A isoform X1Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713152
M3WS15M3WS15_FELCAUBIQUITIN_CONJUGAT_2 domain-containing proteinFelis catus (Cat) (Felis silvestris catus)9685152
A0A2Y9GRI0A0A2Y9GRI0_NEOSCubiquitin-conjugating enzyme E2 A isoform X1Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088152
F6SAT6F6SAT6_MONDOUBIQUITIN_CONJUGAT_2 domain-containing proteinMonodelphis domestica (Gray short-tailed opossum)13616152
A0A2Y9T2T3A0A2Y9T2T3_PHYMCubiquitin-conjugating enzyme E2 APhyseter macrocephalus (Sperm whale) (Physeter catodon)9755152
A0A2K5DE21A0A2K5DE21_AOTNAUBIQUITIN_CONJUGAT_2 domain-containing proteinAotus nancymaae (Ma's night monkey)37293152
A0A096MKL8A0A096MKL8_PAPANUBIQUITIN_CONJUGAT_2 domain-containing proteinPapio anubis (Olive baboon)9555152
A0A340XWB7A0A340XWB7_LIPVEubiquitin-conjugating enzyme E2 A isoform X1Lipotes vexillifer (Yangtze river dolphin)118797152
A0A2R8Z7N0A0A2R8Z7N0_PANPAUBIQUITIN_CONJUGAT_2 domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597152
A0A3Q7MNB5A0A3Q7MNB5_CALURubiquitin-conjugating enzyme E2 ACallorhinus ursinus (Northern fur seal)34884152
A0A2U3VA31A0A2U3VA31_TURTRubiquitin-conjugating enzyme E2 ATursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739152
A0A2Y9DRN4A0A2Y9DRN4_TRIMAubiquitin-conjugating enzyme E2 ATrichechus manatus latirostris (Florida manatee)127582152

Sequence

Representative sequenceiLengthMass (Da)Tools
P49459

Checksumi: 0AAEB5B7770E47E2

FASTA15217,315
        10         20         30         40         50
MSTPARRRLM RDFKRLQEDP PAGVSGAPSE NNIMVWNAVI FGPEGTPFED
60 70 80 90 100
GTFKLTIEFT EEYPNKPPTV RFVSKMFHPN VYADGSICLD ILQNRWSPTY
110 120 130 140 150
DVSSILTSIQ SLLDEPNPNS PANSQAAQLY QENKREYEKR VSAIVEQSWR

DC
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again