Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P52736 Zinc finger protein 133 n=2 Tax=Homo sapiens TaxID=9606 RepID=ZN133_HUMAN MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSLGISFSKPELITQLEQGKETW REEKKCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCAEGNIQPG DPGPGDQEKQQQASEGRPWSDQAEGPEGEGAMPLFGRTKKRTLGAFSRPPQRQPVSSRNG LRGVELEASPAQSGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLLSHQRIHSGEK PYVCGVCEKGFSLKKSLARHQKAHSGEKPIVCRECGRGFNRKSTLIIHERTHSGEKPYMC SECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCSDCG LGFSDRSNLISHQRTHSGEKPYACKECGRCFRQRTTLVNHQRTHSKEKPYVCGVCGHSFS QNSTLISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIVCKDCGRGFSQQSN LIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECGRGFSHQAGLIRH KRKHSREKPYMCRQCGLGFGNKSALITHKRAHSEEKPCVCRECGQGFLQKSHLTLHQMTH TGEKPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYSL

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P52736ZN133_HUMANZinc finger protein 133Homo sapiens (Human)9606654Representative
P52736-5Isoform 5 of ZN133_HUMAN5Homo sapiens (Human)9606657Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
P52736

Checksumi: CF1D47B223A6DD84

FASTA65473,388
        10         20         30         40         50
MAFRDVAVDF TQDEWRLLSP AQRTLYREVM LENYSNLVSL GISFSKPELI
60 70 80 90 100
TQLEQGKETW REEKKCSPAT CPADPEPELY LDPFCPPGFS SQKFPMQHVL
110 120 130 140 150
CNHPPWIFTC LCAEGNIQPG DPGPGDQEKQ QQASEGRPWS DQAEGPEGEG
160 170 180 190 200
AMPLFGRTKK RTLGAFSRPP QRQPVSSRNG LRGVELEASP AQSGNPEETD
210 220 230 240 250
KLLKRIEVLG FGTVNCGECG LSFSKMTNLL SHQRIHSGEK PYVCGVCEKG
260 270 280 290 300
FSLKKSLARH QKAHSGEKPI VCRECGRGFN RKSTLIIHER THSGEKPYMC
310 320 330 340 350
SECGRGFSQK SNLIIHQRTH SGEKPYVCRE CGKGFSQKSA VVRHQRTHLE
360 370 380 390 400
EKTIVCSDCG LGFSDRSNLI SHQRTHSGEK PYACKECGRC FRQRTTLVNH
410 420 430 440 450
QRTHSKEKPY VCGVCGHSFS QNSTLISHRR THTGEKPYVC GVCGRGFSLK
460 470 480 490 500
SHLNRHQNIH SGEKPIVCKD CGRGFSQQSN LIRHQRTHSG EKPMVCGECG
510 520 530 540 550
RGFSQKSNLV AHQRTHSGER PYVCRECGRG FSHQAGLIRH KRKHSREKPY
560 570 580 590 600
MCRQCGLGFG NKSALITHKR AHSEEKPCVC RECGQGFLQK SHLTLHQMTH
610 620 630 640 650
TGEKPYVCKT CGRGFSLKSH LSRHRKTTSV HHRLPVQPDP EPCAGQPSDS

LYSL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again