Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P55347 Homeobox protein PKNOX1 n=15 Tax=Simiiformes TaxID=314293 RepID=PKNX1_HUMAN MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYR HPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPETDNLMVK AIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEPGSPYSPVQSQQIQSAI TGTISPQGIVVPASALQQGNVAMATVAGGTVYQPVTVVTPQGQVVTQTLSPGTIRIQNSQ LQLQLNQDLSILHQDDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTN LTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSIASGVAQPPPS ELTMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEEDAGALA PAHISGLVLENSDSLQ

Members

Expand cluster to 90% or 50% identity.
1 to 15 of 15  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P55347PKNX1_HUMANHomeobox protein PKNOX1Homo sapiens (Human)9606436Representative & Seed
Q96I87Q96I87_HUMANHomeobox-containing protein PKNOX1Homo sapiens (Human)9606436
A0A2K5M4J9A0A2K5M4J9_CERATHomeobox domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531436
H2RAH8H2RAH8_PANTRPBX/knotted 1 homeobox 1Pan troglodytes (Chimpanzee)9598436
A0A2J8UB19A0A2J8UB19_PONABPKNOX1 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601436
A0A096NIR5A0A096NIR5_PAPANHomeobox domain-containing proteinPapio anubis (Olive baboon)9555436
A0A2K5CHA0A0A2K5CHA0_AOTNAHomeobox domain-containing proteinAotus nancymaae (Ma's night monkey)37293436
A0A2K5ZDI6A0A2K5ZDI6_MANLEHomeobox domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568436
G3RD54G3RD54_GORGOPBX/knotted 1 homeobox 1Gorilla gorilla gorilla (Western lowland gorilla)9595436
A0A2K6CKF2A0A2K6CKF2_MACNEHomeobox domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545436
A0A2K5JIU5A0A2K5JIU5_COLAPHomeobox domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983436
E7EPN6E7EPN6_HUMANHomeobox protein PKNOX1Homo sapiens (Human)9606319
A0A2J8UB27A0A2J8UB27_PONABPKNOX1 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601319
A0A2J8M8C9A0A2J8M8C9_PANTRPKNOX1 isoform 1Pan troglodytes (Chimpanzee)9598319
A0A0D9R6R4A0A0D9R6R4_CHLSBPBX/knotted 1 homeobox 1Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711319

Sequence

Representative sequenceiLengthMass (Da)Tools
P55347

Checksumi: 381E901F435AC5F2

FASTA43647,607
        10         20         30         40         50
MMATQTLSID SYQDGQQMQV VTELKTEQDP NCSEPDAEGV SPPPVESQTP
60 70 80 90 100
MDVDKQAIYR HPLFPLLALL FEKCEQSTQG SEGTTSASFD VDIENFVRKQ
110 120 130 140 150
EKEGKPFFCE DPETDNLMVK AIQVLRIHLL ELEKVNELCK DFCSRYIACL
160 170 180 190 200
KTKMNSETLL SGEPGSPYSP VQSQQIQSAI TGTISPQGIV VPASALQQGN
210 220 230 240 250
VAMATVAGGT VYQPVTVVTP QGQVVTQTLS PGTIRIQNSQ LQLQLNQDLS
260 270 280 290 300
ILHQDDGSSK NKRGVLPKHA TNVMRSWLFQ HIGHPYPTED EKKQIAAQTN
310 320 330 340 350
LTLLQVNNWF INARRRILQP MLDSSCSETP KTKKKTAQNR PVQRFWPDSI
360 370 380 390 400
ASGVAQPPPS ELTMSEGAVV TITTPVNMNV DSLQSLSSDG ATLAVQQVMM
410 420 430
AGQSEDESVD STEEDAGALA PAHISGLVLE NSDSLQ
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again