Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_P59594 Spike glycoprotein n=42 Tax=Human SARS coronavirus TaxID=694009 RepID=SPIKE_CVHSA MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFL PFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNS TNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFK HLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSP AQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIY QTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTF FSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCV LAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLND YGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTP SSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQD VNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASY HTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDC NMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFG GFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGL TVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYE NQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLN DILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSK RVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFN GTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKN HTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWL GFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT

Members

Expand cluster to 90% or 50% identity.
1 to 25 of 42  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P59594SPIKE_CVHSASpike glycoproteinHuman SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)6940091,255Representative & Seed
D3KDQ3D3KDQ3_CVHSASpike glycoproteinSARS coronavirus HKU-398492284041,255
D2E1D2D2E1D2_CVHSASpike glycoproteinSARS coronavirus ExoN16274401,255
D2E1E7D2E1E7_CVHSASpike glycoproteinSARS coronavirus wtic-MB6984191,255
A0A3G5BJ39A0A3G5BJ39_CVHSASpike glycoproteinSARS coronavirus Urbani2283301,255
Q309G9Q309G9_CVHSASpike glycoproteinSARS coronavirus ZJ023531451,255
A7J8L4A7J8L4_CVHSASpike glycoproteinHuman SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)6940091,255
Q202E9Q202E9_CVHSASpike glycoproteinHuman SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)6940091,255
Q6V585Q6V585_CVHSASpike glycoproteinSARS coronavirus PUMC012534331,255
Q6WGP3Q6WGP3_CVHSASpike glycoproteinSARS coronavirus ZJ012304711,255
Q6RD53Q6RD53_CVHSASpike glycoproteinSARS coronavirus TW112589641,255
Q6RCW5Q6RCW5_CVHSASpike glycoproteinSARS coronavirus TW92589721,255
Q6RCZ8Q6RCZ8_CVHSASpike glycoproteinSARS coronavirus TW62589691,255
Q6VA89Q6VA89_CVHSASpike glycoproteinSARS coronavirus CUHK-AG022392421,255
Q6RD42Q6RD42_CVHSASpike glycoproteinSARS coronavirus TW22589651,255
Q3S2D2Q3S2D2_CVHSASpike glycoproteinSARS coronavirus ZJ03013447021,255
Q6RCX6Q6RCX6_CVHSASpike glycoproteinSARS coronavirus TW82589711,255
Q6JH38Q6JH38_CVHSASpike glycoproteinSARS coronavirus Sino3-112557291,255
Q6RD09Q6RD09_CVHSASpike glycoproteinSARS coronavirus TW52589681,255
Q6RD31Q6RD31_CVHSASpike glycoproteinSARS coronavirus TW32589661,255
Q6RCY7Q6RCY7_CVHSASpike glycoproteinSARS coronavirus TW72589701,255
Q6UZF0Q6UZF0_CVHSASpike glycoproteinSARS coronavirus PUMC032534351,255
Q6VA78Q6VA78_CVHSASpike glycoproteinSARS coronavirus CUHK-AG032392431,255
Q6UZF4Q6UZF4_CVHSASpike glycoproteinSARS coronavirus PUMC022534341,255
Q6VAA0Q6VAA0_CVHSASpike glycoproteinSARS coronavirus CUHK-AG012392411,255

Sequence

Representative sequenceiLengthMass (Da)Tools
P59594

Checksumi: 1C49ACA2CFD38FC0

FASTA1,255139,125
        10         20         30         40         50
MFIFLLFLTL TSGSDLDRCT TFDDVQAPNY TQHTSSMRGV YYPDEIFRSD
60 70 80 90 100
TLYLTQDLFL PFYSNVTGFH TINHTFGNPV IPFKDGIYFA ATEKSNVVRG
110 120 130 140 150
WVFGSTMNNK SQSVIIINNS TNVVIRACNF ELCDNPFFAV SKPMGTQTHT
160 170 180 190 200
MIFDNAFNCT FEYISDAFSL DVSEKSGNFK HLREFVFKNK DGFLYVYKGY
210 220 230 240 250
QPIDVVRDLP SGFNTLKPIF KLPLGINITN FRAILTAFSP AQDIWGTSAA
260 270 280 290 300
AYFVGYLKPT TFMLKYDENG TITDAVDCSQ NPLAELKCSV KSFEIDKGIY
310 320 330 340 350
QTSNFRVVPS GDVVRFPNIT NLCPFGEVFN ATKFPSVYAW ERKKISNCVA
360 370 380 390 400
DYSVLYNSTF FSTFKCYGVS ATKLNDLCFS NVYADSFVVK GDDVRQIAPG
410 420 430 440 450
QTGVIADYNY KLPDDFMGCV LAWNTRNIDA TSTGNYNYKY RYLRHGKLRP
460 470 480 490 500
FERDISNVPF SPDGKPCTPP ALNCYWPLND YGFYTTTGIG YQPYRVVVLS
510 520 530 540 550
FELLNAPATV CGPKLSTDLI KNQCVNFNFN GLTGTGVLTP SSKRFQPFQQ
560 570 580 590 600
FGRDVSDFTD SVRDPKTSEI LDISPCSFGG VSVITPGTNA SSEVAVLYQD
610 620 630 640 650
VNCTDVSTAI HADQLTPAWR IYSTGNNVFQ TQAGCLIGAE HVDTSYECDI
660 670 680 690 700
PIGAGICASY HTVSLLRSTS QKSIVAYTMS LGADSSIAYS NNTIAIPTNF
710 720 730 740 750
SISITTEVMP VSMAKTSVDC NMYICGDSTE CANLLLQYGS FCTQLNRALS
760 770 780 790 800
GIAAEQDRNT REVFAQVKQM YKTPTLKYFG GFNFSQILPD PLKPTKRSFI
810 820 830 840 850
EDLLFNKVTL ADAGFMKQYG ECLGDINARD LICAQKFNGL TVLPPLLTDD
860 870 880 890 900
MIAAYTAALV SGTATAGWTF GAGAALQIPF AMQMAYRFNG IGVTQNVLYE
910 920 930 940 950
NQKQIANQFN KAISQIQESL TTTSTALGKL QDVVNQNAQA LNTLVKQLSS
960 970 980 990 1000
NFGAISSVLN DILSRLDKVE AEVQIDRLIT GRLQSLQTYV TQQLIRAAEI
1010 1020 1030 1040 1050
RASANLAATK MSECVLGQSK RVDFCGKGYH LMSFPQAAPH GVVFLHVTYV
1060 1070 1080 1090 1100
PSQERNFTTA PAICHEGKAY FPREGVFVFN GTSWFITQRN FFSPQIITTD
1110 1120 1130 1140 1150
NTFVSGNCDV VIGIINNTVY DPLQPELDSF KEELDKYFKN HTSPDVDLGD
1160 1170 1180 1190 1200
ISGINASVVN IQKEIDRLNE VAKNLNESLI DLQELGKYEQ YIKWPWYVWL
1210 1220 1230 1240 1250
GFIAGLIAIV MVTILLCCMT SCCSCLKGAC SCGSCCKFDE DDSEPVLKGV

KLHYT
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again