Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q01130 Serine/arginine-rich splicing factor 2 n=50 Tax=Amniota TaxID=32524 RepID=SRSF2_HUMAN MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFV RFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSR SPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSR SRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS

Members

Expand cluster to 90% or 50% identity.
1 to 25 of 50  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q01130SRSF2_HUMANSerine/arginine-rich splicing factor 2Homo sapiens (Human)9606221Representative
Q3MHR5SRSF2_BOVINSerine/arginine-rich splicing factor 2Bos taurus (Bovine)9913221
Q62093SRSF2_MOUSESerine/arginine-rich splicing factor 2Mus musculus (Mouse)10090221
Q6PDU1SRSF2_RATSerine/arginine-rich splicing factor 2Rattus norvegicus (Rat)10116221
B3KUY1B3KUY1_HUMANSplicing factor, arginine/serine-rich 2, isoform CRA_dHomo sapiens (Human)9606209
A0A2Y9T4Q5A0A2Y9T4Q5_PHYMCserine/arginine-rich splicing factor 2 isoform X2Physeter macrocephalus (Sperm whale) (Physeter catodon)9755209
A0A024R8U5A0A024R8U5_HUMANSplicing factor, arginine/serine-rich 2, isoform CRA_aHomo sapiens (Human)9606221
A0A2Y9PPF9A0A2Y9PPF9_DELLEserine/arginine-rich splicing factor 2Delphinapterus leucas (Beluga whale)9749221
H2R259H2R259_PANTRSRSF2 isoform 1Pan troglodytes (Chimpanzee)9598221
H9ELV2H9ELV2_MACMUSerine/arginine-rich splicing factor 2Macaca mulatta (Rhesus macaque)9544221
F7IJZ7F7IJZ7_CALJASerine/arginine-rich splicing factor 2Callithrix jacchus (White-tufted-ear marmoset)9483221
A0A3Q7PHP3A0A3Q7PHP3_CALURserine/arginine-rich splicing factor 2Callorhinus ursinus (Northern fur seal)34884221
A0A2K6BT71A0A2K6BT71_MACNERRM domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545221
A0A2U4BMF4A0A2U4BMF4_TURTRserine/arginine-rich splicing factor 2Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739221
A0A2Y9LBZ6A0A2Y9LBZ6_ENHLUserine/arginine-rich splicing factor 2Enhydra lutris kenyoni391180221
A0A2K6RAS5A0A2K6RAS5_RHIRORRM domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622221
Q4R7A3Q4R7A3_MACFAMacaca fascicularis brain cDNA clone: QmoA-12513, similar to human splicing factor, arginine/serine-rich 2 (SFRS2), mRNA, RefSeq: NM_003016.1Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541221
A0A341CNU2A0A341CNU2_9CETAserine/arginine-rich splicing factor 2Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337221
A0A2J8Y1F5A0A2J8Y1F5_PONABSRSF2 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601221
A0A4W2HER7A0A4W2HER7_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522221
A0A3Q7UI41A0A3Q7UI41_URSARserine/arginine-rich splicing factor 2Ursus arctos horribilis116960221
A0A452RDS3A0A452RDS3_URSAMSerine and arginine rich splicing factor 2Ursus americanus (American black bear) (Euarctos americanus)9643221
A0A4X2KRD9A0A4X2KRD9_VOMURUncharacterized proteinVombatus ursinus (Common wombat)29139221
A0A2K6GAS0A0A2K6GAS0_PROCORRM domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532221
A0A212D980A0A212D980_CEREHRRM domain-containing proteinCervus elaphus hippelaphus (European red deer)46360221

Sequence

Representative sequenceiLengthMass (Da)Tools
Q01130

Checksumi: 68121AC4D35714FA

FASTA22125,476
        10         20         30         40         50
MSYGRPPPDV EGMTSLKVDN LTYRTSPDTL RRVFEKYGRV GDVYIPRDRY
60 70 80 90 100
TKESRGFAFV RFHDKRDAED AMDAMDGAVL DGRELRVQMA RYGRPPDSHH
110 120 130 140 150
SRRGPPPRRY GGGGYGRRSR SPRRRRRSRS RSRSRSRSRS RSRYSRSKSR
160 170 180 190 200
SRTRSRSRST SKSRSARRSK SKSSSVSRSR SRSRSRSRSR SPPPVSKRES
210 220
KSRSRSKSPP KSPEEEGAVS S
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again