Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q04671 P protein n=2 Tax=Homo sapiens TaxID=9606 RepID=P_HUMAN MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSS WAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEF ITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRCVQWLKV MGLFAFVVLCSILFSLYPDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASG PSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETV SISIRASLQQTQAVPLLMAHQYLRGSVETQVTIATAILAGVYALIIFEIVHRTLAAMLGS LAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVKAYRLSRG RVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGA ATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGICLVLLVCFPLLRLLYWNRKLYNKE PSEIVELKHEIHVWRLTAQRISPASREETAVRRLLLGKVLALEHLLARRLHTFHRQISQE DKNWETNIQELQKKHRISDGILLAKCLTVLGFVIFMFFLNSFVPGIHLDLGWIAILGAIW LLILADIHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYVGEQTALLIKMVPEEQR LIAAIVLVVWVSALASSLIDNIPFTATMIPVLLNLSHDPEVGLPAPPLMYALAFGACLGG NGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCTVGMCYLLVAHVVVGWN

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q04671P_HUMANP proteinHomo sapiens (Human)9606838Representative
UPI0005D02F83P protein isoform X3Homo sapiens (Human)9606846Seed

Sequence

Representative sequenceiLengthMass (Da)Tools
Q04671

Checksumi: A6158B9E55BD7199

FASTA83892,849
        10         20         30         40         50
MHLEGRDGRR YPGAPAVELL QTSVPSGLAE LVAGKRRLPR GAGGADPSHS
60 70 80 90 100
CPRGAAGQSS WAPAGQEFAS FLTKGRSHSS LPQMSSSRSK DSCFTENTPL
110 120 130 140 150
LRNSLQEKGS RCIPVYHPEF ITAEESWEDS SADWERRYLL SREVSGLSAS
160 170 180 190 200
ASSEKGDLLD SPHIRLRLSK LRRCVQWLKV MGLFAFVVLC SILFSLYPDQ
210 220 230 240 250
GKLWQLLALS PLENYSVNLS SHVDSTLLQV DLAGALVASG PSRPGREEHI
260 270 280 290 300
VVELTQADAL GSRWRRPQQV THNWTVYLNP RRSEHSVMSR TFEVLTRETV
310 320 330 340 350
SISIRASLQQ TQAVPLLMAH QYLRGSVETQ VTIATAILAG VYALIIFEIV
360 370 380 390 400
HRTLAAMLGS LAALAALAVI GDRPSLTHVV EWIDFETLAL LFGMMILVAI
410 420 430 440 450
FSETGFFDYC AVKAYRLSRG RVWAMIIMLC LIAAVLSAFL DNVTTMLLFT
460 470 480 490 500
PVTIRLCEVL NLDPRQVLIA EVIFTNIGGA ATAIGDPPNV IIVSNQELRK
510 520 530 540 550
MGLDFAGFTA HMFIGICLVL LVCFPLLRLL YWNRKLYNKE PSEIVELKHE
560 570 580 590 600
IHVWRLTAQR ISPASREETA VRRLLLGKVL ALEHLLARRL HTFHRQISQE
610 620 630 640 650
DKNWETNIQE LQKKHRISDG ILLAKCLTVL GFVIFMFFLN SFVPGIHLDL
660 670 680 690 700
GWIAILGAIW LLILADIHDF EIILHRVEWA TLLFFAALFV LMEALAHLHL
710 720 730 740 750
IEYVGEQTAL LIKMVPEEQR LIAAIVLVVW VSALASSLID NIPFTATMIP
760 770 780 790 800
VLLNLSHDPE VGLPAPPLMY ALAFGACLGG NGTLIGASAN VVCAGIAEQH
810 820 830
GYGFSFMEFF RLGFPMMVVS CTVGMCYLLV AHVVVGWN
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again