Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q0VCN9 Folate receptor 2 (Fetal) n=4 Tax=Bos TaxID=9903 RepID=Q0VCN9_BOVIN MPWKLTPLLLFLGWMTSVCSARTRTDLLNVCMDAKHHKAEPGPEDKLHNQCTPWKKNACC SARVSQELHKDTSSLYNFTWDHCGKMEPACQRHFIQDNCLYECSPNLGPWIQEVNQKWRK ERFLNVPLCKEDCQSWWEDCRTSYTCKSNWHRGWDWTSGSNKCPTGTICRTFEAYFPTPA ALCEGLWSHSYKLSNYSRGSGRCIQMWFDPALGNPNEEVARFYALALTAEAWPQGIRPLL LCLALMLSLWLHD

Members

Expand cluster to 90% or 50% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q0VCN9Q0VCN9_BOVINFolate receptor 2 (Fetal)Bos taurus (Bovine)9913253Representative
A0A5A9PZL6A0A5A9PZL6_9CETAUncharacterized proteinBos mutus (wild yak)72004421Seed
A0A4W2CG31A0A4W2CG31_BOBOXFolate receptor betaBos indicus x Bos taurus (Hybrid cattle)30522253
UPI00005BE3E5folate receptor beta isoform X3Bos taurus (Bovine)9913222

Sequence

Representative sequenceiLengthMass (Da)Tools
Q0VCN9

Checksumi: 79B31A1016A7B816

FASTA25329,333
        10         20         30         40         50
MPWKLTPLLL FLGWMTSVCS ARTRTDLLNV CMDAKHHKAE PGPEDKLHNQ
60 70 80 90 100
CTPWKKNACC SARVSQELHK DTSSLYNFTW DHCGKMEPAC QRHFIQDNCL
110 120 130 140 150
YECSPNLGPW IQEVNQKWRK ERFLNVPLCK EDCQSWWEDC RTSYTCKSNW
160 170 180 190 200
HRGWDWTSGS NKCPTGTICR TFEAYFPTPA ALCEGLWSHS YKLSNYSRGS
210 220 230 240 250
GRCIQMWFDP ALGNPNEEVA RFYALALTAE AWPQGIRPLL LCLALMLSLW

LHD
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again