Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q0VCX4 Catenin beta-1 n=27 Tax=Eutheria TaxID=9347 RepID=CTNB1_BOVIN MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD L

Members

Expand cluster to 90% or 50% identity.
1 to 25 of 27  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q0VCX4CTNB1_BOVINCatenin beta-1Bos taurus (Bovine)9913781Representative & Seed
B6V8E6CTNB1_CANLFCatenin beta-1Canis lupus familiaris (Dog) (Canis familiaris)9615781
A0A2Z4FR65A0A2Z4FR65_CAPHIBeta-cateninCapra hircus (Goat)9925781
A0A2U4CAG5A0A2U4CAG5_TURTRcatenin beta-1Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739781
A0A2Y9L6J3A0A2Y9L6J3_ENHLUcatenin beta-1Enhydra lutris kenyoni391180781
A0A4X1TKY9A0A4X1TKY9_PIGUncharacterized proteinSus scrofa (Pig)9823781
Q8WNW4Q8WNW4_PIGBeta-cateninSus scrofa (Pig)9823781
A0A3Q7WDY5A0A3Q7WDY5_URSARcatenin beta-1Ursus arctos horribilis116960781
M3W0E4M3W0E4_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685781
A0A2Y9G4Y4A0A2Y9G4Y4_NEOSCcatenin beta-1Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088781
A0A2U3X5M1A0A2U3X5M1_ODOROcatenin beta-1 isoform X1Odobenus rosmarus divergens (Pacific walrus)9708781
A0A2Y9F1X5A0A2Y9F1X5_PHYMCcatenin beta-1Physeter macrocephalus (Sperm whale) (Physeter catodon)9755781
A0A2Y9D636A0A2Y9D636_TRIMAcatenin beta-1Trichechus manatus latirostris (Florida manatee)127582781
A0A2Y9MAY9A0A2Y9MAY9_DELLEcatenin beta-1Delphinapterus leucas (Beluga whale)9749781
B1MV73B1MV73_HORSEBeta catenin 1Equus caballus (Horse)9796781
A0A3Q7T804A0A3Q7T804_VULVUcatenin beta-1 isoform X1Vulpes vulpes (Red fox)9627781
A0A3Q7Q0I6A0A3Q7Q0I6_CALURcatenin beta-1Callorhinus ursinus (Northern fur seal)34884781
A0A4U5S3M2A0A4U5S3M2_CAMDRUncharacterized proteinCamelus dromedarius (Dromedary) (Arabian camel)9838781
A0A4U1F6C6A0A4U1F6C6_MONMOUncharacterized proteinMonodon monoceros (Narwhal) (Ceratodon monodon)40151781
U6CUG1U6CUG1_NEOVICatenin beta-1Neovison vison (American mink) (Mustela vison)452646781
A0A5A9Q9U7A0A5A9Q9U7_9CETAUncharacterized proteinBos mutus (wild yak)72004781
G1LYU0G1LYU0_AILMEUncharacterized proteinAiluropoda melanoleuca (Giant panda)9646781
A0A452REL9A0A452REL9_URSAMCatenin beta 1Ursus americanus (American black bear) (Euarctos americanus)9643781
A0A485N765A0A485N765_LYNPACatenin beta-1Lynx pardinus (Iberian lynx) (Felis pardina)191816781
M3YJF4M3YJF4_MUSPFUncharacterized proteinMustela putorius furo (European domestic ferret) (Mustela furo)9669781

Sequence

Representative sequenceiLengthMass (Da)Tools
Q0VCX4

Checksumi: 6148652F953F0723

FASTA78185,511
        10         20         30         40         50
MATQADLMEL DMAMEPDRKA AVSHWQQQSY LDSGIHSGAT TTAPSLSGKG
60 70 80 90 100
NPEEEDVDTT QVLYEWEQGF SQSFTQEQVA DIDGQYAMTR AQRVRAAMFP
110 120 130 140 150
ETLDEGMQIP STQFDAAHPT NVQRLAEPSQ MLKHAVVNLI NYQDDAELAT
160 170 180 190 200
RAIPELTKLL NDEDQVVVNK AAVMVHQLSK KEASRHAIMR SPQMVSAIVR
210 220 230 240 250
TMQNTNDVET ARCTAGTLHN LSHHREGLLA IFKSGGIPAL VKMLGSPVDS
260 270 280 290 300
VLFYAITTLH NLLLHQEGAK MAVRLAGGLQ KMVALLNKTN VKFLAITTDC
310 320 330 340 350
LQILAYGNQE SKLIILASGG PQALVNIMRT YTYEKLLWTT SRVLKVLSVC
360 370 380 390 400
SSNKPAIVEA GGMQALGLHL TDPSQRLVQN CLWTLRNLSD AATKQEGMEG
410 420 430 440 450
LLGTLVQLLG SDDINVVTCA AGILSNLTCN NYKNKMMVCQ VGGIEALVRT
460 470 480 490 500
VLRAGDREDI TEPAICALRH LTSRHQEAEM AQNAVRLHYG LPVVVKLLHP
510 520 530 540 550
PSHWPLIKAT VGLIRNLALC PANHAPLREQ GAIPRLVQLL VRAHQDTQRR
560 570 580 590 600
TSMGGTQQQF VEGVRMEEIV EGCTGALHIL ARDVHNRIVI RGLNTIPLFV
610 620 630 640 650
QLLYSPIENI QRVAAGVLCE LAQDKEAAEA IEAEGATAPL TELLHSRNEG
660 670 680 690 700
VATYAAAVLF RMSEDKPQDY KKRLSVELTS SLFRTEPMAW NETADLGLDI
710 720 730 740 750
GAQGEPLGYR QDDPSYRSFH SGGYGQDALG MDPMMEHEMG GHHPGADYPV
760 770 780
DGLPDLGHAQ DLMDGLPPGD SNQLAWFDTD L
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again