Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q15131 Cyclin-dependent kinase 10 n=3 Tax=Homininae TaxID=207598 RepID=CDK10_HUMAN MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQ TDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYC EQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTA DFGLARAYGVPVKPMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHRPLLP GTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLL HFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPATSEGQSKRCKP

Members

Expand cluster to 90% or 50% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q15131CDK10_HUMANCyclin-dependent kinase 10Homo sapiens (Human)9606360Representative & Seed
A0A2J8J084A0A2J8J084_PANTRCDK10 isoform 1Pan troglodytes (Chimpanzee)9598360
A0A2R9A3I8A0A2R9A3I8_PANPAProtein kinase domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597360

Sequence

Representative sequenceiLengthMass (Da)Tools
Q15131

Checksumi: 25B28560961103F4

FASTA36041,038
        10         20         30         40         50
MAEPDLECEQ IRLKCIRKEG FFTVPPEHRL GRCRSVKEFE KLNRIGEGTY
60 70 80 90 100
GIVYRARDTQ TDEIVALKKV RMDKEKDGIP ISSLREITLL LRLRHPNIVE
110 120 130 140 150
LKEVVVGNHL ESIFLVMGYC EQDLASLLEN MPTPFSEAQV KCIVLQVLRG
160 170 180 190 200
LQYLHRNFII HRDLKVSNLL MTDKGCVKTA DFGLARAYGV PVKPMTPKVV
210 220 230 240 250
TLWYRAPELL LGTTTQTTSI DMWAVGCILA ELLAHRPLLP GTSEIHQIDL
260 270 280 290 300
IVQLLGTPSE NIWPGFSKLP LVGQYSLRKQ PYNNLKHKFP WLSEAGLRLL
310 320 330 340 350
HFLFMYDPKK RATAGDCLES SYFKEKPLPC EPELMPTFPH HRNKRAAPAT
360
SEGQSKRCKP
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again