Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q15468 SCL-interrupting locus protein n=2 Tax=Homo sapiens TaxID=9606 RepID=STIL_HUMAN MEPIYPFARPQMNTRFPSSRMVPFHFPPSKCALWNPTPTGDFIYLHLSYYRNPKLVVTEK TIRLAYRHAKQNKKNSSCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPG DFLIPCKVHTQELCSREMIVHSVDDFSSALKALQCHICSKDSLDCGKLLSLRVHITSRES LDSVEFDLHWAAVTLANNFKCTPVKPIPIIPTALARNLSSNLNISQVQGTYKYGYLTMDE TRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFI IVLYSMTHKEPEFYECFPCDGKIPDFRFQLLTSKETLHLFKNVEPPDKNPIRCELSAESQ NAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKI QPSVPELSLVLDGNFIESNPLPTPLEMVNNENPPLINHLEHLKPLQPQLYDEKHSPEVEA GEPSLRGIPNQLNQDKPALLRHCKVRQPPAYKKGNPHTRNSIKPSSHNGPSHDIFEKLQT VSAGNVQNEEYPIRPSTLNSRQSSLAPQSQPHDFVFSPHNSGRPMELQIPTPPLPSYCST NVCRCCQHHSHIQYSPLNSWQGANTVGSIQDVQSEALQKHSLFHPSGCPALYCNAFCSSS SPIALRPQGDMGSCSPHSNIEPSPVARPPSHMDLCNPQPCTVCMHTPKTESDNGMMGLSP DAYRFLTEQDRQLRLLQAQIQRLLEAQSLMPCSPKTTAVEDTVQAGRQMELVSVEAQSSP GLHMRKGVSIAVSTGASLFWNAAGEDQEPDSQMKQDDTKISSEDMNFSVDINNEVTSLPG SASSLKAVDIPSFEESNIAVEEEFNQPLSVSNSSLVVRKEPDVPVFFPSGQLAESVSMCL QTGPTGGASNNSETSEEPKIEHVMQPLLHQPSDNQKIYQDLLGQVNHLLNSSSKETEQPS TKAVIISHECTRTQNVYHTKKKTHHSRLVDKDCVLNATLKQLRSLGVKIDSPTKVKKNAH NVDHASVLACISPEAVISGLNCMSFANVGMSGLSPNGVDLSMEANAIALKYLNENQLSQL SVTRSNQNNCDPFSLLHINTDRSTVGLSLISPNNMSFATKKYMKRYGLLQSSDNSEDEEE PPDNADSKSEYLLNQNLRSIPEQLGGQKEPSKNDHEIINCSNCESVGTNADTPVLRNITN EVLQTKAKQQLTEKPAFLVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSE TLKQMNSMNSVGTFLDVKRLRQLPKLF

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q15468STIL_HUMANSCL-interrupting locus proteinHomo sapiens (Human)96061,287Representative & Seed
Q5T0D0Q5T0D0_HUMANSCL/TAL1 interrupting locus (Fragment)Homo sapiens (Human)9606592

Sequence

Representative sequenceiLengthMass (Da)Tools
Q15468

Checksumi: 7F15BEDA8717659C

FASTA1,287142,954
        10         20         30         40         50
MEPIYPFARP QMNTRFPSSR MVPFHFPPSK CALWNPTPTG DFIYLHLSYY
60 70 80 90 100
RNPKLVVTEK TIRLAYRHAK QNKKNSSCFL LGSLTADEDE EGVTLTVDRF
110 120 130 140 150
DPGREVPECL EITPTASLPG DFLIPCKVHT QELCSREMIV HSVDDFSSAL
160 170 180 190 200
KALQCHICSK DSLDCGKLLS LRVHITSRES LDSVEFDLHW AAVTLANNFK
210 220 230 240 250
CTPVKPIPII PTALARNLSS NLNISQVQGT YKYGYLTMDE TRKLLLLLES
260 270 280 290 300
DPKVYSLPLV GIWLSGITHI YSPQVWACCL RYIFNSSVQE RVFSESGNFI
310 320 330 340 350
IVLYSMTHKE PEFYECFPCD GKIPDFRFQL LTSKETLHLF KNVEPPDKNP
360 370 380 390 400
IRCELSAESQ NAETEFFSKA SKNFSIKRSS QKLSSGKMPI HDHDSGVEDE
410 420 430 440 450
DFSPRPIPSP HPVSQKISKI QPSVPELSLV LDGNFIESNP LPTPLEMVNN
460 470 480 490 500
ENPPLINHLE HLKPLQPQLY DEKHSPEVEA GEPSLRGIPN QLNQDKPALL
510 520 530 540 550
RHCKVRQPPA YKKGNPHTRN SIKPSSHNGP SHDIFEKLQT VSAGNVQNEE
560 570 580 590 600
YPIRPSTLNS RQSSLAPQSQ PHDFVFSPHN SGRPMELQIP TPPLPSYCST
610 620 630 640 650
NVCRCCQHHS HIQYSPLNSW QGANTVGSIQ DVQSEALQKH SLFHPSGCPA
660 670 680 690 700
LYCNAFCSSS SPIALRPQGD MGSCSPHSNI EPSPVARPPS HMDLCNPQPC
710 720 730 740 750
TVCMHTPKTE SDNGMMGLSP DAYRFLTEQD RQLRLLQAQI QRLLEAQSLM
760 770 780 790 800
PCSPKTTAVE DTVQAGRQME LVSVEAQSSP GLHMRKGVSI AVSTGASLFW
810 820 830 840 850
NAAGEDQEPD SQMKQDDTKI SSEDMNFSVD INNEVTSLPG SASSLKAVDI
860 870 880 890 900
PSFEESNIAV EEEFNQPLSV SNSSLVVRKE PDVPVFFPSG QLAESVSMCL
910 920 930 940 950
QTGPTGGASN NSETSEEPKI EHVMQPLLHQ PSDNQKIYQD LLGQVNHLLN
960 970 980 990 1000
SSSKETEQPS TKAVIISHEC TRTQNVYHTK KKTHHSRLVD KDCVLNATLK
1010 1020 1030 1040 1050
QLRSLGVKID SPTKVKKNAH NVDHASVLAC ISPEAVISGL NCMSFANVGM
1060 1070 1080 1090 1100
SGLSPNGVDL SMEANAIALK YLNENQLSQL SVTRSNQNNC DPFSLLHINT
1110 1120 1130 1140 1150
DRSTVGLSLI SPNNMSFATK KYMKRYGLLQ SSDNSEDEEE PPDNADSKSE
1160 1170 1180 1190 1200
YLLNQNLRSI PEQLGGQKEP SKNDHEIINC SNCESVGTNA DTPVLRNITN
1210 1220 1230 1240 1250
EVLQTKAKQQ LTEKPAFLVK NLKPSPAVNL RTGKAEFTQH PEKENEGDIT
1260 1270 1280
IFPESLQPSE TLKQMNSMNS VGTFLDVKRL RQLPKLF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again