Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q2RFQ9 50S ribosomal protein L5 n=3 Tax=Moorella thermoacetica TaxID=1525 RepID=RL5_MOOTA MARLKEKYLQEIRKALQAKFGYKNIMEIPKLEKIVINMGVSEATQNPKAIDNAVQDLMTI TGQKPVVTKAKKSIAAFKLRQGTSIGCKVTLRGDRMYEFLDRLINVALPRVRDFHGVSPN SFDGRGNYTLGIREQLIFPEIEYDKIDKVRGMDIVMVTTAKSDEEARELLRGFGMPFREH

Members

Expand cluster to 90% or 50% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q2RFQ9RL5_MOOTA50S ribosomal protein L5Moorella thermoacetica (strain ATCC 39073 / JCM 9320)264732180Representative & Seed
A0A1J5NNJ2A0A1J5NNJ2_MOOTH50S ribosomal protein L5Moorella thermoacetica (Clostridium thermoaceticum)1525180
A0A0S6UD15A0A0S6UD15_MOOTH50S ribosomal protein L5Moorella thermoacetica Y721325331180

Sequence

Representative sequenceiLengthMass (Da)Tools
Q2RFQ9

Checksumi: C41827DCA7407341

FASTA18020,507
        10         20         30         40         50
MARLKEKYLQ EIRKALQAKF GYKNIMEIPK LEKIVINMGV SEATQNPKAI
60 70 80 90 100
DNAVQDLMTI TGQKPVVTKA KKSIAAFKLR QGTSIGCKVT LRGDRMYEFL
110 120 130 140 150
DRLINVALPR VRDFHGVSPN SFDGRGNYTL GIREQLIFPE IEYDKIDKVR
160 170 180
GMDIVMVTTA KSDEEARELL RGFGMPFREH
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again