Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q5L3R1 50S ribosomal protein L17 n=24 Tax=Bacillaceae TaxID=186817 RepID=RL17_GEOKA MSYRKLGRTTSQRKALLRDLATDLIINERIETTEARAKELRSVMEKMITLGKRGDLHARR QAAAFIRKEVANSETGQDALQKLFSDIAPRYQDRQGGYTRIMKLGPRRGDGAPMVIIELV

Members

Expand cluster to 90% or 50% identity.
1 to 24 of 24  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q5L3R1RL17_GEOKA50S ribosomal protein L17Geobacillus kaustophilus (strain HTA426)235909120Representative
S7U5E4S7U5E4_9BACI50S ribosomal protein L17Geobacillus sp. WSUCF1886559121Seed
A0A063YZH6A0A063YZH6_9BACI50S ribosomal protein L17Geobacillus sp. CAMR127391482738120
A0A1Q5T1J7A0A1Q5T1J7_9BACI50S ribosomal protein L17Geobacillus proteiniphilus860353120
A0A142D535A0A142D535_9BACI50S ribosomal protein L17Geobacillus sp. JS121813182120
A0A553LRD5A0A553LRD5_9BACI50S ribosomal protein L17Geobacillus sp. LEMMJ022595057120
A0A0N0I4K6A0A0N0I4K6_9BACI50S ribosomal protein L17Geobacillus sp. BCO21547578120
T0NZP9T0NZP9_9BACI50S ribosomal protein L17Geobacillus sp. A81095383120
V6VHC5V6VHC5_9BACI50S ribosomal protein L17Geobacillus sp. MAS11408282120
A0A4R1FW86A0A4R1FW86_9BACI50S ribosomal protein L17Anoxybacillus amylolyticus294699120
A0A063YZL3A0A063YZL3_9BACI50S ribosomal protein L17Geobacillus sp. CAMR54201482739120
A0A0J0V931A0A0J0V931_9BACI50S ribosomal protein L17Geobacillus sp. T61659191120
A0A1V4P8G2A0A1V4P8G2_9BACI50S ribosomal protein L17Geobacillus sp. LEMMY011954237120
A0A223ER52A0A223ER52_9BACI50S ribosomal protein L17Geobacillus thermocatenulatus33938120
A0A1C3D7Y6A0A1C3D7Y6_GEOTH50S ribosomal protein L17Geobacillus thermoleovorans (Bacillus thermoleovorans)33941120
A0A2H5KHZ8A0A2H5KHZ8_BACCL50S ribosomal protein L17Bacillus caldolyticus1394120
A0A0D8BX82A0A0D8BX82_GEOKU50S ribosomal protein L17Geobacillus kaustophilus1462120
U2Y3V6U2Y3V6_GEOKU50S ribosomal protein L17Geobacillus kaustophilus GBlys1337888120
A0A4Q1S4H1A0A4Q1S4H1_9BACI50S ribosomal protein L17Geobacillus sp. PK122508525120
A0A0E0T7Q9A0A0E0T7Q9_GEOS250S ribosomal protein L17Geobacillus sp. (strain Y412MC52)550542120
G8N133G8N133_GEOTH50S ribosomal protein L17Geobacillus thermoleovorans CCB_US3_UF51111068120
A0A1V9CAX2A0A1V9CAX2_9BACI50S ribosomal protein L17Geobacillus zalihae213419120
L7ZSR3L7ZSR3_9BACI50S ribosomal protein L17Geobacillus sp. GHH011233873120
A0A4D7Q6N2A0A4D7Q6N2_GEOKU50S ribosomal protein L17Geobacillus kaustophilus NBRC 1024451220595120

Sequence

Representative sequenceiLengthMass (Da)Tools
Q5L3R1

Checksumi: 3C4DFA6678A7DB85

FASTA12013,630
        10         20         30         40         50
MSYRKLGRTT SQRKALLRDL ATDLIINERI ETTEARAKEL RSVMEKMITL
60 70 80 90 100
GKRGDLHARR QAAAFIRKEV ANSETGQDAL QKLFSDIAPR YQDRQGGYTR
110 120
IMKLGPRRGD GAPMVIIELV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again