Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q5SM01 Peptide chain release factor RF2 n=3 Tax=Thermus thermophilus TaxID=274 RepID=RF2_THET8 MRLASQSAILVKVWTWNASRNAWKASGGIFDIPQKETRLKELERRLEDPSLWNDPEAARK VSQEAARLRRTVDTFRSLESDLQGLLELMEELPAEEREALKPELEEAAKKLDELYHQTLL NFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQVEVVDLTPGPEAGIDYA QILVKGENAYGLLSPEAGVHRLVRPSPFDASGRRHTSFAGVEVIPEVDEEVEVVLKPEEL RIDVMRASGPGGQGVNTTDSAVRVVHLPTGITVTCQTTRSQIKNKELALKILKARLYELE RKKREEELKALRGEVRPIEWGSQIRSYVLDKNYVKDHRTGLMRHDPENVLDGDLMDLIWA GLEWKAGRRQGTEEVEAE

Members

Expand cluster to 90% or 50% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q5SM01RF2_THET8Peptide chain release factor RF2Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)300852378Representative & Seed
Q72GJ6Q72GJ6_THET2Peptide chain release factor 2Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)262724378
A0A510IGM8A0A510IGM8_THETHPeptide chain release factor 2Thermus thermophilus274378

Sequence

Representative sequenceiLengthMass (Da)Tools
Q5SM01

Checksumi: 55B4AC9C891AEEB7

FASTA37842,733
        10         20         30         40         50
MRLASQSAIL VKVWTWNASR NAWKASGGIF DIPQKETRLK ELERRLEDPS
60 70 80 90 100
LWNDPEAARK VSQEAARLRR TVDTFRSLES DLQGLLELME ELPAEEREAL
110 120 130 140 150
KPELEEAAKK LDELYHQTLL NFPHAEKNAI LTIQPGAGGT EACDWAEMLL
160 170 180 190 200
RMYTRFAERQ GFQVEVVDLT PGPEAGIDYA QILVKGENAY GLLSPEAGVH
210 220 230 240 250
RLVRPSPFDA SGRRHTSFAG VEVIPEVDEE VEVVLKPEEL RIDVMRASGP
260 270 280 290 300
GGQGVNTTDS AVRVVHLPTG ITVTCQTTRS QIKNKELALK ILKARLYELE
310 320 330 340 350
RKKREEELKA LRGEVRPIEW GSQIRSYVLD KNYVKDHRTG LMRHDPENVL
360 370
DGDLMDLIWA GLEWKAGRRQ GTEEVEAE
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again