Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q7Z5L9 Interferon regulatory factor 2-binding protein 2 n=3 Tax=Homo sapiens TaxID=9606 RepID=I2BP2_HUMAN MAAAVAVAAASRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRVEFVIETARQLK RAHGCFPEGRSPPGAAASAAAKPPPLSAKDILLQQQQQLGHGGPEAAPRAPQALERYPLA AAAERPPRLGSDFGSSRPAASLAQPPTPQPPPVNGILVPNGFSKLEEPPELNRQSPNPRR GHAVPPTLVPLMNGSATPLPTALGLGGRAAASLAAVSGTAAASLGSAQPTDLGAHKRPAS VSSSAAVEHEQREAAAKEKQPPPPAHRGPADSLSTAAGAAELSAEGAGKSRGSGEQDWVN RPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAVARTARKRKPS PEPEGEVGPPKINGEAQPWLSTSTEGLKIPMTPTSSFVSPPPPTASPHSNRTTPPEAAQN GQSPMAALILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREVGGQGAG NTGGLEPVHPASLPDSSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQ QGASGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKERDS

Members

Expand cluster to 90% or 50% identity.
1 to 3 of 3  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q7Z5L9I2BP2_HUMANInterferon regulatory factor 2-binding protein 2Homo sapiens (Human)9606587Representative & Seed
B4DTU9B4DTU9_HUMANcDNA FLJ52600, highly similar to Homo sapiens interferon regulatory factor 2 binding protein 2 (IRF2BP2), mRNAHomo sapiens (Human)9606124
Q7Z5L9-3Isoform 3 of I2BP2_HUMAN3Homo sapiens (Human)9606163

Sequence

Representative sequenceiLengthMass (Da)Tools
Q7Z5L9

Checksumi: 2B36B7EE2C3B96A6

FASTA58761,025
        10         20         30         40         50
MAAAVAVAAA SRRQSCYLCD LPRMPWAMIW DFTEPVCRGC VNYEGADRVE
60 70 80 90 100
FVIETARQLK RAHGCFPEGR SPPGAAASAA AKPPPLSAKD ILLQQQQQLG
110 120 130 140 150
HGGPEAAPRA PQALERYPLA AAAERPPRLG SDFGSSRPAA SLAQPPTPQP
160 170 180 190 200
PPVNGILVPN GFSKLEEPPE LNRQSPNPRR GHAVPPTLVP LMNGSATPLP
210 220 230 240 250
TALGLGGRAA ASLAAVSGTA AASLGSAQPT DLGAHKRPAS VSSSAAVEHE
260 270 280 290 300
QREAAAKEKQ PPPPAHRGPA DSLSTAAGAA ELSAEGAGKS RGSGEQDWVN
310 320 330 340 350
RPKTVRDTLL ALHQHGHSGP FESKFKKEPA LTAGRLLGFE ANGANGSKAV
360 370 380 390 400
ARTARKRKPS PEPEGEVGPP KINGEAQPWL STSTEGLKIP MTPTSSFVSP
410 420 430 440 450
PPPTASPHSN RTTPPEAAQN GQSPMAALIL VADNAGGSHA SKDANQVHST
460 470 480 490 500
TRRNSNSPPS PSSMNQRRLG PREVGGQGAG NTGGLEPVHP ASLPDSSLAT
510 520 530 540 550
SAPLCCTLCH ERLEDTHFVQ CPSVPSHKFC FPCSRQSIKQ QGASGEVYCP
560 570 580
SGEKCPLVGS NVPWAFMQGE IATILAGDVK VKKERDS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again