Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q8BSK8 Ribosomal protein S6 kinase beta-1 n=6 Tax=Mus musculus TaxID=10090 RepID=KS6B1_MOUSE MRRRRRRDGFYLAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG IEQMDVTVSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL

Members

Expand cluster to 90% or 50% identity.
1 to 6 of 6  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8BSK8KS6B1_MOUSERibosomal protein S6 kinase beta-1Mus musculus (Mouse)10090525Representative & Seed
Q8BSK8-2Isoform 2 of KS6B1_MOUSEAlpha IIMus musculus (Mouse)10090502
O35670O35670_MOUSEp70 s6k, p85 s6k (Fragment)Mus musculus (Mouse)1009047
Q9CST0Q9CST0_MOUSEUncharacterized protein (Fragment)Mus musculus (Mouse)10090351
UPI0003D70FDEribosomal protein S6 kinase beta-1 isoform 3Mus musculus (Mouse)10090472
UPI0003D7554Bribosomal protein S6 kinase beta-1 isoform X4Mus musculus (Mouse)10090322

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8BSK8

Checksumi: 5B3C09F6BB365EE2

FASTA52559,146
        10         20         30         40         50
MRRRRRRDGF YLAPDFRHRE AEDMAGVFDI DLDQPEDAGS EDELEEGGQL
60 70 80 90 100
NESMDHGGVG PYELGMEHCE KFEISETSVN RGPEKIRPEC FELLRVLGKG
110 120 130 140 150
GYGKVFQVRK VTGANTGKIF AMKVLKKAMI VRNAKDTAHT KAERNILEEV
160 170 180 190 200
KHPFIVDLIY AFQTGGKLYL ILEYLSGGEL FMQLEREGIF MEDTACFYLA
210 220 230 240 250
EISMALGHLH QKGIIYRDLK PENIMLNHQG HVKLTDFGLC KESIHDGTVT
260 270 280 290 300
HTFCGTIEYM APEILMRSGH NRAVDWWSLG ALMYDMLTGA PPFTGENRKK
310 320 330 340 350
TIDKILKCKL NLPPYLTQEA RDLLKKLLKR NAASRLGAGP GDAGEVQAHP
360 370 380 390 400
FFRHINWEEL LARKVEPPFK PLLQSEEDVS QFDSKFTRQT PVDSPDDSTL
410 420 430 440 450
SESANQVFLG FTYVAPSVLE SVKEKFSFEP KIRSPRRFIG SPRTPVSPVK
460 470 480 490 500
FSPGDFWGRG ASASTANPQT PVEYPMETSG IEQMDVTVSG EASAPLPIRQ
510 520
PNSGPYKKQA FPMISKRPEH LRMNL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again