Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q8K4J7 Resistin n=2 Tax=Rattus norvegicus TaxID=10116 RepID=Q8K4J7_RAT MKNLSFLLLFLFFLVLGLLGPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSS RGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q8K4J7Q8K4J7_RATResistinRattus norvegicus (Rat)10116114Representative & Seed
Q70Q42Q70Q42_RATResistinRattus norvegicus (Rat)1011667

Sequence

Representative sequenceiLengthMass (Da)Tools
Q8K4J7

Checksumi: 8D823DA33A961201

FASTA11412,293
        10         20         30         40         50
MKNLSFLLLF LFFLVLGLLG PSMSLCPMDE AISKKINQDF SSLLPAAMKN
60 70 80 90 100
TVLHCWSVSS RGRLASCPEG TTVTSCSCGS GCGSWDVRED TMCHCQCGSI
110
DWTAARCCTL RVGS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again