Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q96B97 SH3 domain-containing kinase-binding protein 1 n=2 Tax=Homo sapiens TaxID=9606 RepID=SH3K1_HUMAN MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKEM KKDPLTNKAPEKPLHEVPSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELK VGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTG SESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPV EKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKD CIDVGWWEGELNGRRGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVIKQGAGTTERKHE IKKIPPERPEMLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLSRPGALPPR RPERPVGPLTHTRGDSPKIDLAGSSLSGILDKDLSDRSNDIDLEGFDSVVSSTEKLSHPT TSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKTSKTVTIS QVSDNKASLPPKPGTMAAGGGGPAPLSSAAPSPLSSSLGTAGHRANSPSLFGTEGKPKME PAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKK ALQSK

Members

Expand cluster to 90% or 50% identity.
1 to 2 of 2  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96B97SH3K1_HUMANSH3 domain-containing kinase-binding protein 1Homo sapiens (Human)9606665Representative & Seed
Q5JPT6Q5JPT6_HUMANGIG10Homo sapiens (Human)9606665

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96B97

Checksumi: 3BD350FCDB14BD4C

FASTA66573,126
        10         20         30         40         50
MVEAIVEFDY QAQHDDELTI SVGEIITNIR KEDGGWWEGQ INGRRGLFPD
60 70 80 90 100
NFVREIKKEM KKDPLTNKAP EKPLHEVPSG NSLLSSETIL RTNKRGERRR
110 120 130 140 150
RRCQVAFSYL PQNDDELELK VGDIIEVVGE VEEGWWEGVL NGKTGMFPSN
160 170 180 190 200
FIKELSGESD ELGISQDEQL SKSSLRETTG SESDGGDSSS TKSEGANGTV
210 220 230 240 250
ATAAIQPKKV KGVGFGDIFK DKPIKLRPRS IEVENDFLPV EKTIGKKLPA
260 270 280 290 300
TTATPDSSKT EMDSRTKSKD YCKVIFPYEA QNDDELTIKE GDIVTLINKD
310 320 330 340 350
CIDVGWWEGE LNGRRGVFPD NFVKLLPPDF EKEGNRPKKP PPPSAPVIKQ
360 370 380 390 400
GAGTTERKHE IKKIPPERPE MLPNRTEEKE RPEREPKLDL QKPSVPAIPP
410 420 430 440 450
KKPRPPKTNS LSRPGALPPR RPERPVGPLT HTRGDSPKID LAGSSLSGIL
460 470 480 490 500
DKDLSDRSND IDLEGFDSVV SSTEKLSHPT TSRPKATGRR PPSQSLTSSS
510 520 530 540 550
LSSPDIFDSP SPEEDKEEHI SLAHRGVDAS KKTSKTVTIS QVSDNKASLP
560 570 580 590 600
PKPGTMAAGG GGPAPLSSAA PSPLSSSLGT AGHRANSPSL FGTEGKPKME
610 620 630 640 650
PAASSQAAVE ELRTQVRELR SIIETMKDQQ KREIKQLLSE LDEEKKIRLR
660
LQMEVNDIKK ALQSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again