Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef100_Q96Q83 Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 n=6 Tax=Homininae TaxID=207598 RepID=ALKB3_HUMAN MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQ QVVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTG IREDITYQQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNL YRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLD HGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW

Members

Expand cluster to 90% or 50% identity.
1 to 6 of 6  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q96Q83ALKB3_HUMANAlpha-ketoglutarate-dependent dioxygenase alkB homolog 3Homo sapiens (Human)9606286Representative & Seed
H2Q3G1H2Q3G1_PANTRALKBH3 isoform 4Pan troglodytes (Chimpanzee)9598286
A0A2R9A6R0A0A2R9A6R0_PANPAFe2OG dioxygenase domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597286
E9PRD0E9PRD0_HUMANAlpha-ketoglutarate-dependent dioxygenase alkB homolog 3 (Fragment)Homo sapiens (Human)960660
A0A2J8LHR5A0A2J8LHR5_PANTRALKBH3 isoform 11 (Fragment)Pan troglodytes (Chimpanzee)959860
UPI000006E69Balpha-ketoglutarate-dependent dioxygenase alkB homolog 3 isoform X3Pan troglodytes (Chimpanzee)9598139

Sequence

Representative sequenceiLengthMass (Da)Tools
Q96Q83

Checksumi: F6563635B1F217D7

FASTA28633,375
        10         20         30         40         50
MEEKRRRARV QGAWAAPVKS QAIAQPATTA KSHLHQKPGQ TWKNKEHHLS
60 70 80 90 100
DREFVFKEPQ QVVRRAPEPR VIDREGVYEI SLSPTGVSRV CLYPGFVDVK
110 120 130 140 150
EADWILEQLC QDVPWKQRTG IREDITYQQP RLTAWYGELP YTYSRITMEP
160 170 180 190 200
NPHWHPVLRT LKNRIEENTG HTFNSLLCNL YRNEKDSVDW HSDDEPSLGR
210 220 230 240 250
CPIIASLSFG ATRTFEMRKK PPPEENGDYT YVERVKIPLD HGTLLIMEGA
260 270 280
TQADWQHRVP KEYHSREPRV NLTFRTVYPD PRGAPW
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again